SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020554 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020554
Domain Number 1 Region: 36-163
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 5.92e-31
Family MaoC-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020554   Gene: ENSOGAG00000034068   Transcript: ENSOGAT00000031113
Sequence length 168
Comment pep:novel scaffold:OtoGar3:GL873523.1:39334363:39334869:-1 gene:ENSOGAG00000034068 transcript:ENSOGAT00000031113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPIIAIHRLWWAGLRRRVCLNQPVLNRQPCQRMRVKVGDRAELSRAFTHRDVATFSELT
GDVNPLHLNEDFAKHTKFGKTIVHGVLINGLISALLGTEMPGPGCVFLSQEINFPAPLYI
GEVVLASAEVKKLKRFIAVIEVSCSVIESRKTVMEGWVKVMVPEIPKS
Download sequence
Identical sequences H0XWR1
XP_003782555.1.62490 ENSOGAP00000020554 ENSOGAP00000020554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]