SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020640 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020640
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 2.28e-17
Family DNA polymerase processivity factor 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020640   Gene: ENSOGAG00000028665   Transcript: ENSOGAT00000032218
Sequence length 391
Comment pep:known_by_projection scaffold:OtoGar3:GL873653.1:2793218:2799596:-1 gene:ENSOGAG00000028665 transcript:ENSOGAT00000032218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEYGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAVTPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGKSSRLVVQLHCKYGVRK
THNLSFQDCESLQAVFDPASCPHMLHAPARVLGEAVLPFPPALAEVTLGIGRGRRVILRS
YQEEEEDNTVKAMVTEMSIGEEDFQQLQAQEGVAVTFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLNGHFVLATLSETDPHSKDLGSSELHQPVPQLQNYSTPHMEDFAS
DDIESFMIAMETTLGSEGSRVLPSISLSPGPQLPNSPDPQSEEEDEAEPTTVPGTPPPKK
FRSLFFGSILAPVHSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences H0XWZ7
ENSOGAP00000020640 ENSOGAP00000020640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]