SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020726 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020726
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.71e-20
Family THAP domain 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000020726
Domain Number - Region: 154-231
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0983
Family Cystathionine synthase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020726   Gene: ENSOGAG00000028798   Transcript: ENSOGAT00000024666
Sequence length 273
Comment pep:known_by_projection scaffold:OtoGar3:GL873619.1:5882853:5896399:-1 gene:ENSOGAG00000028798 transcript:ENSOGAT00000024666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQRMGREHWVPSYHQHLCSE
HFAPSCFQWRWGVRYLRPDAVPSIFQAPPPKSQRGTQSTKKRVVPPAGPQEATPQPPGCA
IPSSGPVHLVVLGPGSGTPEAAATVLLPSPPPSPTFAGRHPDIPPLQAQAGLGAALGALQ
QRVRRLQRRHQRHQAQLRTLEQLAQQLHGQSLLARARRGLQPVGMAQISGPEESQAFTII
CGGPEIAVILAQSPASPTVDAKPELLDTRSPSA
Download sequence
Identical sequences H0XX83
ENSOGAP00000020726 ENSOGAP00000020726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]