SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020849 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020849
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000159
Family LEM domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020849   Gene: ENSOGAG00000029264   Transcript: ENSOGAT00000030295
Sequence length 256
Comment pep:novel scaffold:OtoGar3:GL873768.1:1143559:1145351:1 gene:ENSOGAG00000029264 transcript:ENSOGAT00000030295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYAVLSDTELAAVLRQYNIPHGPVVGSTRKLYEKKIFEYETQRRRLSPPSSSASFSYR
FSDSDSASVDSDMYDLPKKEDALLYQSKGYNDDYYEESYLTTRTYGEPESVGTSKGFRQP
GTSDADTFHHQVRDDSFFSSEEEGKDRERMYGQDSAYQSIAHYRPVSNISRSSLGMSYYP
ASSSASSVSSSSSSSPSWLARRAIRPEKQAPGVALGQDRQVPLWGQLLLFLVFAAFLLFV
YYSMQAEEGNPFWREP
Download sequence
Identical sequences B5FW91
XP_003802607.1.62490 ENSOGAP00000020849 ENSOGAP00000020849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]