SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021159 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000021159
Domain Number - Region: 75-159
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0125
Family Heme oxygenase HemO (PigA) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021159   Gene: ENSOGAG00000016305   Transcript: ENSOGAT00000016308
Sequence length 264
Comment pep:known_by_projection scaffold:OtoGar3:GL873661.1:1021814:1022605:1 gene:ENSOGAG00000016305 transcript:ENSOGAT00000016308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGRLLWRLLAEEARYSTPVGRLLLPVLLGFRLVLLAASGPGIYGDEQSEFVCHTQQAGC
KAACFDALHPLSPLRFWTLQVMLVAVPSALYMGFTLYHVIWHWEESEKVKKEEETLPHEG
QSSRDAPGAQSPLLLWAYVAQLGARLALEGAALGGQYHLYGFQVPSSFACRREPCLGSIT
CNLSRPSEKTVFLKTMFGVSGFCLLFTLLELVLLGLTRWWETQKHNTSSSNYCPTSESTR
RCKEPTGNFPVVETKEQFREAGER
Download sequence
Identical sequences H0XYG6
ENSOGAP00000021159 ENSOGAP00000021159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]