SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021277 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021277
Domain Number 1 Region: 390-690
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.57e-72
Family Protein kinases, catalytic subunit 0.000000425
Further Details:      
 
Domain Number 2 Region: 228-347
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 14-101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-21
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000021277
Domain Number - Region: 119-207
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0262
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021277   Gene: ENSOGAG00000026382   Transcript: ENSOGAT00000033692
Sequence length 888
Comment pep:known_by_projection scaffold:OtoGar3:GL873607.1:821715:846790:1 gene:ENSOGAG00000026382 transcript:ENSOGAT00000033692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTE
YGSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQ
PYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFV
FPLCDARSRAPKPRELCRDECEVLESDLCRREYSIARSDPLILMRLQLPKCEALPLPESP
DAANCMRIGIPAERLGHYHQCYNGSGADYRGTASTTKSGHQCQPWALQHPHSHHLSSADF
PELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIP
LVIACLFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLIGQHKQAKLKEISLSTVRF
MEELGEDRFGKVYKGHLFGPTPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPN
IVCLLGVVTKDQPLSMVFSYCPHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHV
VAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLSVKISDLGLFREVYSADYYKLMGNSLLP
IRWMSPEAIMYGKFSVDSDIWSYGVVLWEVFSYGLQPYCGCSNQDVVEMIRGRQVLPCPD
DCPAWVYALMVECWNEFPSRRPRFKDIHSRLRAWGNLSNYTSSAQTSGASNTTQTSSLST
SPVSNVSNARYAGPKQKAQPFPQPPFIPMKGQVRPLVPPPQLYIPVNGYQPVPAYGAYLP
NFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTE
DAQNVPEDVSQSPVQEAEEEEEGSVPETELLGDNDTLQVDEAQVQLEA
Download sequence
Identical sequences H0XYT4
ENSOGAP00000021277 ENSOGAP00000021277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]