SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021413 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021413
Domain Number 1 Region: 59-96
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000000000471
Family Ribosomal protein L36 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021413   Gene: ENSOGAG00000032891   Transcript: ENSOGAT00000032372
Sequence length 96
Comment pep:known_by_projection scaffold:OtoGar3:GL873745.1:1068097:1068387:-1 gene:ENSOGAG00000032891 transcript:ENSOGAT00000032372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLVRRMVASVVSPLLRLSSRAANPPAFSMLLAGPLRGAGSLLLRGPLPCLQPALGFK
TKGVLKKRCKDCYLVKRRGRWFIYCKTNPRHKQRQM
Download sequence
Identical sequences H0XZ70
XP_003802075.1.62490 XP_012668314.1.62490 ENSOGAP00000021413 ENSOGAP00000021413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]