SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021431 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021431
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily POZ domain 1.46e-27
Family BTB/POZ domain 0.0018
Further Details:      
 
Domain Number 2 Region: 386-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000032
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021431   Gene: ENSOGAG00000026628   Transcript: ENSOGAT00000028983
Sequence length 467
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:4255076:4256479:1 gene:ENSOGAG00000026628 transcript:ENSOGAT00000028983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSTHLPSVPSSPICNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELR
AHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLL
VASGLQMWQVVDQCSEILRELESSGGGISSRGATSYHTLLSSTSTTSSPRSWCIRSSFQT
PVQYCASTESPVGGEGSELGEVLQIQVEEEEEEEEEEDQGSAVLSQTPQSQRVSGSLTHP
AGSHPLPISVTPLRLPESESASLELPTPPAALPPKVFYIKQEPLESKEEISGGGTQSGGA
KEETKVFPGGDTEGNGELGFLLPSGAGATSGGGGPSWKPVDLHGNEILSGGGGPGGTGQA
VHGPVKLGGTPPADGKLFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHL
TEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK
Download sequence
Identical sequences H0XZ88
XP_003789148.1.62490 ENSOGAP00000021431 ENSOGAP00000021431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]