SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021532 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021532
Domain Number 1 Region: 7-379
Classification Level Classification E-value
Superfamily ALDH-like 1.62e-102
Family ALDH-like 0.000000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021532   Gene: ENSOGAG00000028240   Transcript: ENSOGAT00000024503
Sequence length 380
Comment pep:novel scaffold:OtoGar3:GL873525.1:31270086:31303102:1 gene:ENSOGAG00000028240 transcript:ENSOGAT00000024503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQTMDALNGGMLFSSAYVMVVEVCVKILHYYAGWADKIQGRTIPADGNVFTYTRHEPIG
VCGQINPWNYPLGAIIMKLAPALSCGNTVIVKPAEQTPLTALQVASLIKEVSLLSQNIHK
NLSSFSATENYIVDKRLLSSVGMYVAWLEMNLNLKCSKLAKESMKRVSIKPLCGQLTAVL
LYIKTLDNALEFAHRGVFFHQGQCCVAASRLFVEESIYDEFVKRSVELAKKYVLGNPLTP
GVSQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAK
EEIFGPVQQIMKFKSLDDVIKRANNTHYGLAAGVFTKDLDKAITVSSALQAGMVWVNCYM
MMSSQCPFGGYKMSGNGREM
Download sequence
Identical sequences H0XZI9
ENSOGAP00000021532 ENSOGAP00000021532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]