SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021627 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021627
Domain Number 1 Region: 281-455,502-577
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-38
Family Kelch motif 0.0019
Further Details:      
 
Domain Number 2 Region: 6-126
Classification Level Classification E-value
Superfamily POZ domain 1.64e-24
Family BTB/POZ domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021627   Gene: ENSOGAG00000029313   Transcript: ENSOGAT00000028920
Sequence length 588
Comment pep:known_by_projection scaffold:OtoGar3:GL873691.1:116255:118021:-1 gene:ENSOGAG00000029313 transcript:ENSOGAT00000028920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLIASN
DMKTTDELFITIDPNYLSPVTVDQLLEYFYSGKVVISEQNVEELLRGAQYFNTPRLRIHC
NDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGSMHFMRCPPVIF
GRLLRDENLHVLNEDQALSALINWVYFRKDEREKYFKKFFNYINLNAVSNKTLMFASNKL
VGLENSSAHATLIESVLMDRKQERPCSLLTYQRKGALLDSVVILGGQKAHGKFNDGVFAY
IIQENLWLKLSEMPYRAAALSATAAGRYIYISGGTTEQISGLKTAWRYDMDDNSWTKLPD
LPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVIT
KGDRNLYIVTGRCLVKGYISRVGVVDCFDTNTGDVVQCITFPIEFNHRPLLSFHQDNILC
VHSHRQSVEINLQKIKASKTTTSVPLLPNNCPLDVSHAICSIGDSKVFVCGGVTTASDVQ
TKDYTINPNAYLLDQKTGEWKILAPPPEALDCPACCLAKLPCKILQRI
Download sequence
Identical sequences H0XZT4
XP_003800270.1.62490 ENSOGAP00000021627 ENSOGAP00000021627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]