SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021877 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021877
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily POZ domain 2.55e-32
Family Tetramerization domain of potassium channels 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021877   Gene: ENSOGAG00000005206   Transcript: ENSOGAT00000005206
Sequence length 260
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:24290381:24291163:1 gene:ENSOGAG00000005206 transcript:ENSOGAT00000005206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYIL
NFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRV
QTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQD
PNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDS
SHPHALDFMNNKIIRLIRYR
Download sequence
Identical sequences A0A2K5BX36 A0A2K5PAB9 A0A2K6ELE2 A0A2K6V922 F7ASN9 G3R3J8 H0Y0I4 H2Q4H2 L8YFH6 Q4G0X4
ENSPTRP00000007078 ENSGGOP00000022681 9598.ENSPTRP00000007078 9606.ENSP00000339340 9796.ENSECAP00000004058 ENSP00000339340 ENSGGOP00000022681 ENSPTRP00000007078 HR6062 gi|71143104|ref|NP_001025030.1| ENSP00000339340 ENSOGAP00000021877 ENSECAP00000004058 ENSOGAP00000021877 ENSECAP00000004058 ENSP00000339340 NP_001025030.1.87134 NP_001025030.1.92137 XP_003365419.1.31192 XP_003780914.1.62490 XP_003805208.2.60992 XP_003935093.1.74449 XP_004051928.2.27298 XP_004683298.1.23501 XP_005273985.1.92137 XP_006161961.1.99106 XP_006718580.1.92137 XP_006718581.1.92137 XP_006926713.1.64745 XP_007939085.1.48129 XP_008506508.1.77740 XP_008564287.1.73410 XP_008966526.1.60992 XP_008966532.1.60992 XP_009422088.1.37143 XP_009422089.1.37143 XP_009422090.1.37143 XP_009422091.1.37143 XP_011366664.1.92234 XP_011543257.1.92137 XP_012325006.1.9421 XP_012325007.1.9421 XP_012325008.1.9421 XP_012325009.1.9421 XP_012506471.1.63892 XP_012580814.1.23501 XP_014448496.1.99106 XP_014715146.1.49734 XP_015455950.1.64745 XP_016017107.1.101085 XP_017374180.1.71028 XP_018892392.1.27298 XP_018892393.1.27298 XP_019581943.1.88060 XP_019581945.1.88060 XP_019581946.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]