SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021991 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021991
Domain Number 1 Region: 379-480
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.05e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021991   Gene: ENSOGAG00000026695   Transcript: ENSOGAT00000028495
Sequence length 1307
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:11121446:11131496:1 gene:ENSOGAG00000026695 transcript:ENSOGAT00000028495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASVVSSSPSLFSCPSHGPDMSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHWPCPGPSP
ADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPP
SSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGT
LATLQYALACVKQVQANQEYYQQWSLEEGEPCDMDMSTYTLEELEHITSEYTLRNQDTFS
VAVSFLTGRIVYISEQAGILLRCKRDVFRGARFSELLAPQDVGVFYGSTAPSRLPTWGTG
ASAGSGLKDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIA
ERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPED
RPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKV
RTAPLNEDVFTPLAPIPAPSLDTDIQELSEQIHRLLLQPVHSSSPSGLCGVGPVTSPGPL
HSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQGQQLFIESRAQPPSRPHLPATS
IFKAKALPFQSSDPEPEMAPALIQAPLALAPEEAERKEASNCSYQQINCLDSILRYLESC
NIPSTTKRKCASSSSYTASSASDDDKQRTGPVPVGTKKDPSSTMLSGEGASPQKEPVVGG
TLSPLTLANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPS
PTVAPDPAPDAYRPVGLTKAVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSAPGCHH
GPAPPGRRHHCRSKAKRSRHHQTPRAEAPCYVSHPSPVPPSAAWPPPPATTPFPAVVQPY
PFPVFSPRGGPQPLPPAPTSVPPATFPTPLVTPMVALVLPNYLFPAPSSYPYGAPQTSAE
GPLTPASQSPSPSLPPLPPSPPHCPDSPLFNSRCSSPLQLNLLQLEEPPRAEGGTVAGGP
GSNAGPPPPSEEAAEPEARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLG
SGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSVDSSEAEAGAAQARAEPGDQVIKY
VLQDPIWLLMANADQKVMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAV
HSWVRKGQLPRALDVMACVDCSSSAQDPGHPDDPLFSELDGLGLEPMEEGGGEGVSGGGS
GEGEGLEEAQAQVEAKVSSSQDLAMEEEEQGGNLPSPALPTIENGTT
Download sequence
Identical sequences H0Y0U8
ENSOGAP00000021991 ENSOGAP00000021991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]