SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022053 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022053
Domain Number 1 Region: 14-180
Classification Level Classification E-value
Superfamily TIMP-like 1.1e-67
Family Tissue inhibitor of metalloproteinases, TIMP 0.000000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022053   Gene: ENSOGAG00000006918   Transcript: ENSOGAT00000024215
Sequence length 191
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:3547006:3557222:1 gene:ENSOGAG00000006918 transcript:ENSOGAT00000024215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCQQAPVYPERLLMIRAKAVSVKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFI
YTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKVHITLCDFIVPWDTLSTTQKKSLNHRYQ
MGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAP
PKQEFLDIEDP
Download sequence
Identical sequences H0Y110
ENSOGAP00000022053 ENSOGAP00000022053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]