SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022105 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022105
Domain Number 1 Region: 246-569
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.63e-67
Family Glutamine synthetase catalytic domain 0.00063
Further Details:      
 
Domain Number 2 Region: 136-242
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 5.75e-20
Family Glutamine synthetase, N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022105   Gene: ENSOGAG00000026375   Transcript: ENSOGAT00000034375
Sequence length 572
Comment pep:known_by_projection scaffold:OtoGar3:GL873554.1:7913661:7939148:-1 gene:ENSOGAG00000026375 transcript:ENSOGAT00000034375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNVEKEKLLQDTTKDENNETEANRTNKLRRTRKKVTKPHVCSTEVGEMDLSHSNERMTNQ
MECHKSGDTSHPGVGPGSATSHPSHEDKDSQDQTTVIKPPSPQTSVSTSSGELNPNSDCT
RDINQILTTPQLSSRMKHIKQAMAKNHLQFVRFEATDLHGVSRSKSIPAHFFQEKVVHGV
YMPRGYLELIPNPRDNEVNHIRATCFNSDIVLMPELSTFRVLPWAERTARVICDTFTVTG
EPLLTSPRYIAKRQLNRLQDAGFSLLSAFIYDFCIFGVPEIINSKTISFPATTLLNNHDQ
PFMQELVDGLYHTGANVESFSSSTRPGQMEICFLPEFGISAADNAFTLRTGVKEVARKYN
YIASFFIETGFCNSGILSHSLWDVGGKKNMFCNSSGIEQLTVTGRKWLAGLLKHSAALSC
LMAPAVSCRKRYSKESKDLKDSVPTTWGYNDNSCAFNIKCHGEKGTRVENKLGSATANPY
LVLAATVAAGLDGLLGSDEASAGPEGNTDPYQSKPSEIPLKLEDALVALEEDQCLREALG
ETFIRYFVAMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences H0Y162
ENSOGAP00000022105 ENSOGAP00000022105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]