SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022106 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022106
Domain Number 1 Region: 31-512
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-185
Family ALDH-like 0.000000000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022106   Gene: ENSOGAG00000027154   Transcript: ENSOGAT00000033056
Sequence length 517
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:1977977:1979569:1 gene:ENSOGAG00000027154 transcript:ENSOGAT00000033056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRLVPRLLHLHGRTATYSSAAALPNPIPNPDIRYNQLFINNEWQDAVSKKTFPTVNPS
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHMDIDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
GHAVEQCHEALFFNMGQCCCAGSRTFVEESIYDEFLERTVEKAKQRKVGNPFQLDTQQGP
QVDKEQFEKILGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences H0Y163
ENSOGAP00000022106 XP_012657920.1.62490 ENSOGAP00000022106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]