SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022138 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022138
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily POZ domain 3.06e-27
Family BTB/POZ domain 0.00082
Further Details:      
 
Domain Number 2 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000349
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 291-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000478
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000022138
Domain Number - Region: 244-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0675
Family Classic zinc finger, C2H2 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022138   Gene: ENSOGAG00000031512   Transcript: ENSOGAT00000034817
Sequence length 378
Comment pep:known_by_projection scaffold:OtoGar3:GL873802.1:700765:702039:-1 gene:ENSOGAG00000031512 transcript:ENSOGAT00000034817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPEHGGRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPATS
RDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLRD
KDRKQDLETPTPPAQRLGQPSRLWPAWTPDLCPAVQKTKSHSVEVQAAFPLPSSRPSPWQ
APGELDQALDLSLKPGPRQDTVHSPCILQTPLYSHKQQEAQPLVKDEQDSLSEQEDDNSP
RSPHSPPKPPFVPLCSQLFPSSHVLQLHLSAHFRERDSTRSRFSPDSAVPTCPLCGKTFS
CTYTLKRHERTHSGEKPYTCVQCGRGFQYSHNLSRHAVVHTREKPHACRWCQRRFTQSGD
LYRHVRKFHCGLVKSLLV
Download sequence
Identical sequences H0Y195
ENSOGAP00000022138 ENSOGAP00000022138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]