SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022179 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022179
Domain Number 1 Region: 6-164
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-42
Family Dual specificity phosphatase-like 0.000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022179   Gene: ENSOGAG00000025640   Transcript: ENSOGAT00000029225
Sequence length 173
Comment pep:novel scaffold:OtoGar3:GL873520.1:16435672:16436193:-1 gene:ENSOGAG00000025640 transcript:ENSOGAT00000029225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPMNHPAPVEVAYRNMRFLITHNPTRATLNGFIEELKKHGVTTIVRVCEATYDPALVEK
EGIQFLDWPFDDGSSPSNEIVDDWLSLVNIKFREEPGCCIAVHCVAGLGRTPVLVALALI
ESGMKNEDAVQFIREKRRGAFNSKQLLYLEKYHSKMRLCFQDCSGHRNICCIQ
Download sequence
Identical sequences H0Y1D6
ENSOGAP00000022179 ENSOGAP00000022179 XP_012657555.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]