SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022310 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022310
Domain Number 1 Region: 203-353
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.33e-47
Family Eukaryotic ODC-like 0.000000494
Further Details:      
 
Domain Number 2 Region: 43-220
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.38e-41
Family Alanine racemase-like, N-terminal domain 0.0000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022310   Gene: ENSOGAG00000009893   Transcript: ENSOGAT00000009893
Sequence length 398
Comment pep:novel scaffold:OtoGar3:GL873637.1:64187:65555:-1 gene:ENSOGAG00000009893 transcript:ENSOGAT00000009893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNINNEEFDCHFLDEGFTAKDILDQKNEVSSSDDKDAFYVADLGDILKKHRRWLKALPR
VTPFYAVKCNDSRAIVKTLAAIGTGFXLVLRIATDDSKAVCRLSVKFGATLKTSRILLER
AKELNIDVIGVSFHVGSGCTDPETFVQAISDARWVFDMGAEVGFSMYLLDIGGGFPGSED
VKLKFEEITGIISPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVWKEQIGS
DDEDESSEQTFMYYVNDGVYGLFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDVL
DWIVEQCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYCVMSGPARQLVQQIQNP
DYLPKVEEQDVGPLPVSCAWESGMKRHPATCASASINV
Download sequence
Identical sequences H0Y1R7
ENSOGAP00000022310 ENSOGAP00000022310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]