SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022343 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000022343
Domain Number - Region: 148-195
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0314
Family Methionine synthase SAM-binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022343   Gene: ENSOGAG00000025709   Transcript: ENSOGAT00000027294
Sequence length 286
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:2652452:2661248:-1 gene:ENSOGAG00000025709 transcript:ENSOGAT00000027294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERELEALAARPARPAETPFQALVEAAGGRGQVLLVGELWEREQSRALLRDFARAVFPPE
PAAAKPGGAATEGAGPGAARWAQRAPGAAARAIRSPLVFVLCRESSLAAREPRRRLREML
RDVRGRRRAGGALVGVLVAEAGPEDAVALGLRLLEALLRTVFGRQAGGPVQAAAYCPGYP
ASSLAVQAAACRALQAAGPRRPGEIAREGPGLPGLLACFSWGPWSRRKDRDVAVSSLPAQ
DNSQEPEEELALTAVFPNGDCEDLGRGSKAQDGVIHTPAEPAGDSR
Download sequence
Identical sequences H0Y1V0
ENSOGAP00000022343 ENSOGAP00000022343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]