SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000022400 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000022400
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily ALDH-like 6.15e-79
Family ALDH-like 0.00000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000022400   Gene: ENSOGAG00000028240   Transcript: ENSOGAT00000028986
Sequence length 218
Comment pep:novel scaffold:OtoGar3:GL873525.1:31290600:31308369:1 gene:ENSOGAG00000028240 transcript:ENSOGAT00000028986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDNALEFAHRGVFFHQGQCCVAASRLFVEESIYDEFVKRSVELAKKYVLGNPLTPGVSQG
PQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFG
PVQQIMKFKSLDDVIKRANNTHYGLAAGVFTKDLDKAITVSSALQAGMVWVNCYMMMSSQ
CPFGGYKMSGNGREMGEYGLYEYTEVKTVTMKISQKNS
Download sequence
Identical sequences H0Y207
ENSOGAP00000022400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]