SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002214 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002214
Domain Number 1 Region: 51-528
Classification Level Classification E-value
Superfamily ALDH-like 6.94e-133
Family ALDH-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002214   Gene: ENSOGAG00000002475   Transcript: ENSOGAT00000002478
Sequence length 540
Comment pep:known_by_projection scaffold:OtoGar3:GL873679.1:4081689:4119860:-1 gene:ENSOGAG00000002475 transcript:ENSOGAT00000002478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLPRAVCVHAAKTSKLSAPWNRPVAFMSSLLINQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWQVWADIPAPKRGEIVRQIGDA
LRDKIQILGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPAHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIGFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDANVLYGPLHTRQAVDMFLGAVEKAKKEGGTVVYGGKKVMDRPGNYVEPTIVTGLAH
DASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMKRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences H0WKT6
ENSOGAP00000002214 ENSOGAP00000002214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]