SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002895 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002895
Domain Number 1 Region: 142-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.83e-86
Family Eukaryotic proteases 0.00000000871
Further Details:      
 
Domain Number 2 Region: 52-157
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000575
Family Hepsin, N-terminal domain 0.00000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002895   Gene: ENSOGAG00000003239   Transcript: ENSOGAT00000003244
Sequence length 417
Comment pep:known_by_projection scaffold:OtoGar3:GL873619.1:5029038:5046455:1 gene:ENSOGAG00000003239 transcript:ENSOGAT00000003244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKEGGQTVPCCSGPKVAALTAGTLLLLMGIGAASWAIATVLLRSDQEPLYPVQVSPVD
ARLTVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALAHSELDVRTVGANGTSGFFCV
DEGRLPHAQRLLDVISVCDCPRGHFLATICQDCGRRKLPVDRIVGGQDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPSSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGPDFYGNQIKPKMFCAGYAEGGIDACQGDSGGPFVCE
DSISRTSRWRLCGIVSWGTGCALAHKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences H0WMD5
XP_003796146.1.62490 XP_012664604.1.62490 ENSOGAP00000002895 ENSOGAP00000002895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]