SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003981 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003981
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.78e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 1.53e-34
Family Filamin repeat (rod domain) 0.00000337
Further Details:      
 
Domain Number 3 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 9.34e-32
Family Filamin repeat (rod domain) 0.000000955
Further Details:      
 
Domain Number 4 Region: 1525-1642
Classification Level Classification E-value
Superfamily E set domains 1.4e-31
Family Filamin repeat (rod domain) 0.0000238
Further Details:      
 
Domain Number 5 Region: 1623-1738
Classification Level Classification E-value
Superfamily E set domains 8.01e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 6 Region: 1038-1127
Classification Level Classification E-value
Superfamily E set domains 5.67e-30
Family Filamin repeat (rod domain) 0.00000434
Further Details:      
 
Domain Number 7 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 1.85e-29
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 8 Region: 720-843
Classification Level Classification E-value
Superfamily E set domains 6.67e-29
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 9 Region: 1419-1460,1492-1558
Classification Level Classification E-value
Superfamily E set domains 2.04e-28
Family Filamin repeat (rod domain) 0.0000057
Further Details:      
 
Domain Number 10 Region: 1849-1943
Classification Level Classification E-value
Superfamily E set domains 2.67e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 11 Region: 643-753
Classification Level Classification E-value
Superfamily E set domains 3.94e-28
Family Filamin repeat (rod domain) 0.00054
Further Details:      
 
Domain Number 12 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 1.53e-27
Family Filamin repeat (rod domain) 0.00074
Further Details:      
 
Domain Number 13 Region: 2219-2315
Classification Level Classification E-value
Superfamily E set domains 2.74e-27
Family Filamin repeat (rod domain) 0.00000932
Further Details:      
 
Domain Number 14 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 5.27e-27
Family Filamin repeat (rod domain) 0.00054
Further Details:      
 
Domain Number 15 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 2.07e-26
Family Filamin repeat (rod domain) 0.0000038
Further Details:      
 
Domain Number 16 Region: 2029-2124
Classification Level Classification E-value
Superfamily E set domains 2.2e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 17 Region: 2542-2632
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 18 Region: 536-638
Classification Level Classification E-value
Superfamily E set domains 2.8e-24
Family Filamin repeat (rod domain) 0.00019
Further Details:      
 
Domain Number 19 Region: 2413-2504
Classification Level Classification E-value
Superfamily E set domains 5.2e-24
Family Filamin repeat (rod domain) 0.0000143
Further Details:      
 
Domain Number 20 Region: 2320-2411
Classification Level Classification E-value
Superfamily E set domains 7.34e-24
Family Filamin repeat (rod domain) 0.0000172
Further Details:      
 
Domain Number 21 Region: 352-448
Classification Level Classification E-value
Superfamily E set domains 1.25e-23
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 22 Region: 2141-2236
Classification Level Classification E-value
Superfamily E set domains 4.87e-21
Family Filamin repeat (rod domain) 0.000011
Further Details:      
 
Domain Number 23 Region: 951-1051
Classification Level Classification E-value
Superfamily E set domains 1.77e-20
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 24 Region: 1939-2027
Classification Level Classification E-value
Superfamily E set domains 6.01e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1786-1862
Classification Level Classification E-value
Superfamily E set domains 3.14e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003981   Gene: ENSOGAG00000004454   Transcript: ENSOGAT00000004463
Sequence length 2633
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:29605375:29758900:-1 gene:ENSOGAG00000004454 transcript:ENSOGAT00000004463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
HMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGKGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDNDKNKTYSVEYLPKVAGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEATGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTMELLVEDKGNQLYRCVYKP
MQPGPHVVKVSFAGDTIPKSPFIVQVGEACSPNACRASGRGLQPRGVRIRETADFKVDTK
AAGSGELSVIVKGPKGLEELVKQKGFLDGVYTFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESVGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIQPATGDYNPDLVQAYGPGLEKSGC
IVNNPTEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYICSYTPLKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPTSPFRVKVD
PSHDASKVKAEGPGLSRTGVENGKPTHFTVYTKGAGKAPLNVQFNSSLPGDAVKDLDIID
NYDYSHTVKYTPAQQGSMQVLVTYGGDPIPKSPFSVSVAAPLDLSKIKINGLENRVEVGK
DQEFTIDTRGAGGQGKLDVTILSPSRKVVPCLVAPVTGRESSAAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLKDGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKVDIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAISDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLIMKYGGEVVPHFPARVKVDPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECLVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTHKLNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCTAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARIL
QSFTVDSSKAGLAPLEVRVLGPRADEMDSQSWRSPLKAISEFFKGDPKGDFMETGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSA
YGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRATVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPFSPYRIRATQTGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
TAVDEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDM
SAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHITGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGTTGVQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSSGTANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences H0WPY0
ENSOGAP00000003981 XP_003785594.1.62490 ENSOGAP00000003981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]