SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004120 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004120
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-30
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 10-66
Classification Level Classification E-value
Superfamily L27 domain 5.1e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004120   Gene: ENSOGAG00000004616   Transcript: ENSOGAT00000004617
Sequence length 220
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:37148751:37300646:1 gene:ENSOGAG00000004616 transcript:ENSOGAT00000004617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMH
ETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIY
ISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVL
EEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences H0WQA3
ENSOGAP00000004120 ENSOGAP00000004120 ENSSSCP00000001003 ENSSSCP00000001003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]