SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009477 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009477
Domain Number 1 Region: 2468-2657
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.27e-87
Family BRCA2 helical domain 0.0000000236
Further Details:      
 
Domain Number 2 Region: 3037-3171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-49
Family Single strand DNA-binding domain, SSB 0.00000543
Further Details:      
 
Domain Number 3 Region: 2658-2790
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.62e-45
Family Single strand DNA-binding domain, SSB 0.000000802
Further Details:      
 
Domain Number 4 Region: 2820-2952
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.09e-36
Family BRCA2 tower domain 0.0000106
Further Details:      
 
Domain Number 5 Region: 2791-2820,2954-3036
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-32
Family Single strand DNA-binding domain, SSB 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009477   Gene: ENSOGAG00000010588   Transcript: ENSOGAT00000010591
Sequence length 3406
Comment pep:known_by_projection scaffold:OtoGar3:GL873639.1:315573:415772:-1 gene:ENSOGAG00000010588 transcript:ENSOGAT00000010591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGSKERPTFFEIFKTRCNEADLGPISLNWFEELSSEATPFSSEPVEESEYKIISYESH
VFKTPQRKPFYRQLASTPLIFKEQGPTLPLFQSPVKELDKCKLDLGNNIANSKHKSHHTG
NAKMDQAGDVTSPLLSSRLSESPVLQYTHVTPQREKSVVCGSLFHTPKFVKGQTQKHISE
SLGAEVDPDMSWSSSLATPPTLSSTVLIVRSEDASEIVFPNDTTAILKSYFSNRDESLKE
NDRLISSVTDHENKNEREARSCGLGKILGNSFDEVNSCKEYFGKSVPNILEDKVRKAIAD
TSEEDSFSLCFKYKTRNLRKVRKDNTRKKVFHETKTGEYEEAKKQIKEKHSIISEMEPND
SDLLDSNEAKQKPFGNESDKISKEIVESCASEWSHLTLSGLSGTQMEKISPLHISCNQNN
SEKDLVDTEKECTDFITSENSLPCISNIPKPEKILNEKTVVNKGGEPQHLESYEDSILAV
KPAISGIPRTASLFQDINKPIFKIRESSEETSSAVFMGSMTDPNVKEETETSESNLEIYT
ICSQKEDSLCPSSIDDESRLATIAHTSVPLKNTGLISTLKKKTKKFIYAINDETSYQGKK
IQKDQKSEITNCSAQFESNVFQAPLSFTNDNSGLLNSSVKRNCLQNDSEEPALSLTSSCG
TLLRKCCHNKSNSPNNPVISQDFDYKEAKINEEKLQPFITSEMDYLSCQQERQCENDPKS
ENVSAIKEKVLATACYPVVHHSEVECSGMHIQSQKSLLYNHDNTSTLTLSSKDPWSESVV
ISSKKESYKMSEKERRKSCKVGFELTKNIFAEKNQEVCSLNENSKNAEPLLPENYITASP
SVKVQFNQNKNLSMIQKEETTLISKILDNPNSEELFQDNENFVCQVTNGRNNLILGNSKE
LPEADLSCVKEPFLENSTMVVHADVGDRQAVQVLITKELDSSDTVYDFPEENRNSVKQHL
KVTLDQDLKPDTSLVIDKKSNKNDCMDKQAGLLNPISNHNFGGGFRTASNKEIKFSEHNI
KKSKMLFKDIEEQYPASLICVESINALELRNQKKLSKPHMLVSESINTVSSYVQSSPFVS
NSENNQTPPQMLFSKQNFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPNLIMQS
NTFDVPANQMSLLNTTSEERKDVDLNVSSVGQVETSKKFEGAVQVKQKFTCLSENNCNKS
ASGYLTCENEVEFRGFYSARGKKLNVSSEALQKAVKLFGDIENISEETSTEVDPRSFSSS
KCNDSIVSAFKIESHNNTNLNEKNNKCQLVLQNIEMTTDAFVDKSTENCKRNIIENDNKC
VAANRKTCNLGESDSSDSGKNDTIYIHKDANDLPCTDQHNVYFKLPSQFVKEGNTQMKAS
LSDLTCLEIVKEEETCYVDTSNKEQLNASHMDQNRKDFEVFDISFQTASGKNIKVSKESL
NKVVNFFDPKTEEELNNFFLNSKLLSGISKNKVDILSHEEIDMFKNEILKESISIDTQNQ
LSTLQQQPECENKKIKQATLLSFHTASGKKVKVAKESLEKVRNLFDEEKQAISKISLNSQ
RAKIQKDRGERTCKEGLVLACKTVEITTVPKCEEMNSLGDNVENHVSNPTAVLPKPLSDH
FYRQSENISTPNVSLKVKVCENVEKETAKSPATCYTNQSPYSAVENSALAFYTGHGRKIS
VSQASLFKAKKWLREELGDQPEEINSDKNYVGNPSHGSGSNSIITENGKNHLPEKQDSAY
LSFSSMSNYSYHSDFYCSHDSGYLSKNTTDSSIEPVVKNIEDERNINFSEVTSTVREANA
YPQTVHKDTCIQKLVTNSSLCTNENTAFKLSVSNSDNFEVETPAFSTASGKIVHVSRETI
KKVKEIFTDNCSKVIQMDTKSKSSTCQTRIVSDYYKTLDDSEDSLPNSTDEESSMHSHKI
FADIQNVHILRDQSMLGLDKVSTLSPCDVSLKTSSLCNTGKFPELVSSTNPEIFSTASGK
SIQVSESSLQQARQVFSEIEEHAKQHFSKVSFKNNEEYSDQFTREEKVIHVPQKLISQKG
FSCNVVNSPAFSGFSTASGKQVSVSESALHKVKGMLEEFDLIKTDCTLQHPPTSRPGISK
FPSLPCVDKRTAEYSMNSEMKKAYSTEFKLLNNFNIESNTSENNHSIKVPPYMSQFKQDK
QQLVLGTKVSLVENIHILGKEQALPKNIKMGIGKTETFPDVPMKTNIEVSSTYYKDSENY
FETEAVEIAKAFMEDGELTDSEPLSHAEHTRFTCQENEETVWLNSRIGKRRGDNHVSFGE
PSIKRNLLNEFDRILENQEKSLKVSKSTPDGTMKDRRLFMQHVYLEPITCGPFCTTKKRQ
GIQNPNFTAPGQEFLSKSHFYEHLTSENSSSNLSVLGQPFYKVPATRSKEMRHSISTGKS
TKIFVPPFKTKSHFHRDKQCASNTVVEENKQKQNTDEHDSGDSENNNSEIHQLNKNNSNQ
ACEEEPLDLITSLQNARDTQDMRIKKKQRHHISPQPGSLYLAKTSSLPRISLKAAVGGRV
PSACSHKQLYMYGVSKHCIKINSKNAESFQFHIQDYFGKEYLWAGKGIQLADGGWLIPSN
DGKAGKEEFYRALCDTPGVDPKLISRVWVYNHYRWIIWKLAAMEFAFPKEFANRCLSPER
VLLQLKYRYDLEIDRSRRSALKKIMEKDDTAAKTLVLCVSDIISLSANICETSNSKTNSE
DTKKVSVIELTDGWYAVKALLDPPLLALLKNGRLSVGQKIIIHGAELLGSPEACTPLEAP
QSLMLKISANSTRPARWYTKLGFFPDPRPFPLRLSSLFSDGGNVGCADIIIQRTYPIQWM
EKTSSGLYIFRNEREEEKEAAKYAEAQQKRLEALFTKIQAEFEEREDNNNNNFLPFSNVA
TWTVPVRRYRDVCFLFQYVKWSQCYFSEEQLRALNNHRQMLNDKKQAQIQLEFRKAMESA
EQGEQGLSRDVTTVWKLRIISCAKEETDSVTLSIWCPSTELYSLLTEGKRYRIYHLAASK
SKIKSEKANIQLAATKKTQYQELPASDEILFQVYQPREPLHFNRLLDPDFQPPCCEVDLI
GVVVSVVKKTVLGLAPLVYLSDECHNLLAIKFWIDLNEDIIKLHALIAASNLLWRPESKS
GIPTLFAGDFSMFSASPKESHFQETFNKMRNTIENIDIFCKDAENKLIHMLNASDPKWCT
PTKDSTSELHTAQTVLGTGNKFLISSPNSEINYQSPSSLCTPKVKLVSTPISAQMTSKSC
CKGEKAIDDPKSCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRSIVTKYETPI
KKKELNSPQMPSPKKFIEISPLESNLIADEELALINTQALLSSSAGEDQCVSISEPPGTT
TTNSKDYLRLKRHCTTSLNKEPKNPQVSTEDCATNMQDTSIIKDIS
Download sequence
Identical sequences H0X313
ENSOGAP00000009477 ENSOGAP00000009477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]