SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009941 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009941
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.09e-45
Family Molybdopterin synthase subunit MoaE 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009941   Gene: ENSOGAG00000011108   Transcript: ENSOGAT00000011110
Sequence length 189
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:43821454:43832971:1 gene:ENSOGAG00000011108 transcript:ENSOGAT00000011110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLETSSSCFNQETRSPLSPPSVEDSAFEPSRKDVDEVKEKSKDIIKFTEEKLSVDEVS
QLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKIFSEIRQKWPIKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLAAVNYAIDHLKAKVPIWKKEMYEESSSSWKRN
KECFWAPND
Download sequence
Identical sequences H0X442
ENSOGAP00000009941 ENSOGAP00000009941 XP_012668065.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]