SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013006 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013006
Domain Number 1 Region: 225-475
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.13e-91
Family Eukaryotic proteases 0.0000531
Further Details:      
 
Domain Number 2 Region: 130-236
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-17
Family Hepsin, N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013006   Gene: ENSOGAG00000014513   Transcript: ENSOGAT00000014519
Sequence length 479
Comment pep:known_by_projection scaffold:OtoGar3:GL873647.1:2140428:2161833:-1 gene:ENSOGAG00000014513 transcript:ENSOGAT00000014519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEMVSQDLEVEPNLRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISSVAPDADEV
AAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCGSAG
RSWDFLPVHWAVRVSGQNAVLQVFTAASWKTMCSDDWKGHYAKVACAQLGFPSHVSSDSL
RVSSLEGQFQEEFVSINHLLPDDKVTALHHSVYVSFREECASGHVVTLKCTVCGLRRGYS
SRIVGGNESVLSQWPWQVSLQFQGYHLCGGSVITPQWIVTAAHCVYDLYLPKSWTIQVGL
VSLLDSPAPSHLVEKIIYHSKYKPKRLGNDIALMKLAGPLTFNEVIQPVCLPNSEESFPD
GKVCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLRGGVD
SCQGDSGGPLVCQERRVWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQMERDLKT
Download sequence
Identical sequences H0XBD3
ENSOGAP00000013006 ENSOGAP00000013006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]