SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013686 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013686
Domain Number 1 Region: 32-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1044-1156
Classification Level Classification E-value
Superfamily E set domains 3.07e-36
Family Filamin repeat (rod domain) 0.0000051
Further Details:      
 
Domain Number 3 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 5.14e-36
Family Filamin repeat (rod domain) 0.0000237
Further Details:      
 
Domain Number 4 Region: 1522-1641
Classification Level Classification E-value
Superfamily E set domains 2.6e-34
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 5 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 8.12e-33
Family Filamin repeat (rod domain) 0.00046
Further Details:      
 
Domain Number 6 Region: 1435-1543
Classification Level Classification E-value
Superfamily E set domains 3.27e-32
Family Filamin repeat (rod domain) 0.0000293
Further Details:      
 
Domain Number 7 Region: 1860-1955
Classification Level Classification E-value
Superfamily E set domains 3.54e-31
Family Filamin repeat (rod domain) 0.0000035
Further Details:      
 
Domain Number 8 Region: 671-778
Classification Level Classification E-value
Superfamily E set domains 4.59e-30
Family Filamin repeat (rod domain) 0.00032
Further Details:      
 
Domain Number 9 Region: 2036-2138
Classification Level Classification E-value
Superfamily E set domains 9.75e-30
Family Filamin repeat (rod domain) 0.0000191
Further Details:      
 
Domain Number 10 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 1.97e-29
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 11 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 3.47e-29
Family Filamin repeat (rod domain) 0.0000132
Further Details:      
 
Domain Number 12 Region: 1158-1266
Classification Level Classification E-value
Superfamily E set domains 4.4e-28
Family Filamin repeat (rod domain) 0.000087
Further Details:      
 
Domain Number 13 Region: 2233-2328
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 14 Region: 279-392
Classification Level Classification E-value
Superfamily E set domains 2.74e-27
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 15 Region: 2427-2519
Classification Level Classification E-value
Superfamily E set domains 4.27e-26
Family Filamin repeat (rod domain) 0.0000111
Further Details:      
 
Domain Number 16 Region: 1630-1741
Classification Level Classification E-value
Superfamily E set domains 1.1e-25
Family Filamin repeat (rod domain) 0.0000675
Further Details:      
 
Domain Number 17 Region: 2334-2425
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 18 Region: 2555-2646
Classification Level Classification E-value
Superfamily E set domains 2.67e-24
Family Filamin repeat (rod domain) 0.0000161
Further Details:      
 
Domain Number 19 Region: 564-665
Classification Level Classification E-value
Superfamily E set domains 3.74e-24
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 20 Region: 768-870
Classification Level Classification E-value
Superfamily E set domains 1.84e-23
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 21 Region: 378-474
Classification Level Classification E-value
Superfamily E set domains 1.64e-21
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 22 Region: 2156-2249
Classification Level Classification E-value
Superfamily E set domains 4.87e-21
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 23 Region: 958-1062
Classification Level Classification E-value
Superfamily E set domains 4.67e-20
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 24 Region: 1961-2058
Classification Level Classification E-value
Superfamily E set domains 5.47e-18
Family Filamin repeat (rod domain) 0.0000933
Further Details:      
 
Domain Number 25 Region: 1797-1877
Classification Level Classification E-value
Superfamily E set domains 6.67e-17
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013686   Gene: ENSOGAG00000015265   Transcript: ENSOGAT00000015287
Sequence length 2647
Comment pep:known_by_projection scaffold:OtoGar3:GL873768.1:1111860:1134691:-1 gene:ENSOGAG00000015265 transcript:ENSOGAT00000015287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHTRAGQSAAGAAPGGGSDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPAGQKGTVESQLEARGDSTYRCSYQPTMEGVYMVHVTFAGMPIPRSPYIVTVGQACNP
GACRAIGRGLQPKGVRAKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ASVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGFAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGISVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAVVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTFDGIPVPGSPFPLEAIAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHIVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGNAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNNPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEPGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTTKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYIICVRFGGEHVPNSPFQVTA
LAGDQPTVQPPLRSQQLSPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYVPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGDPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECSEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKAASTPQHGTPGPGPTDASKVVAKGLGLSKAYIGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYMLVVKWGDEHIPGS
PYRVVVP
Download sequence
Identical sequences H0XCY5
ENSOGAP00000013686 ENSOGAP00000013686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]