SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017037 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017037
Domain Number 1 Region: 139-201
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000272
Family VWC domain 0.0027
Further Details:      
 
Domain Number 2 Region: 426-495
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000638
Family VWC domain 0.0085
Further Details:      
 
Domain Number 3 Region: 253-319
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000167
Family VWC domain 0.0094
Further Details:      
 
Domain Number 4 Region: 1092-1155
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000001
Family VWC domain 0.01
Further Details:      
 
Domain Number 5 Region: 544-610
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000492
Family VWC domain 0.0063
Further Details:      
 
Domain Number 6 Region: 720-786
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000638
Family VWC domain 0.0097
Further Details:      
 
Domain Number 7 Region: 839-904
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000178
Family VWC domain 0.012
Further Details:      
 
Domain Number 8 Region: 897-962
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000241
Family VWC domain 0.0087
Further Details:      
 
Domain Number 9 Region: 372-433
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000115
Family VWC domain 0.0042
Further Details:      
 
Domain Number 10 Region: 663-726
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000167
Family VWC domain 0.024
Further Details:      
 
Domain Number 11 Region: 955-1031
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000439
Family VWC domain 0.012
Further Details:      
 
Domain Number 12 Region: 311-373
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family VWC domain 0.079
Further Details:      
 
Domain Number 13 Region: 779-838
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000178
Family VWC domain 0.085
Further Details:      
 
Domain Number 14 Region: 1424-1489
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000932
Family ATI-like 0.05
Further Details:      
 
Domain Number 15 Region: 202-260
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000136
Family VWC domain 0.021
Further Details:      
 
Domain Number 16 Region: 1044-1090
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000115
Family VWC domain 0.0062
Further Details:      
 
Domain Number 17 Region: 491-546
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000921
Family VWC domain 0.038
Further Details:      
 
Domain Number 18 Region: 95-136
Classification Level Classification E-value
Superfamily FnI-like domain 0.00001
Family VWC domain 0.044
Further Details:      
 
Domain Number 19 Region: 624-669
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000575
Family VWC domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017037   Gene: ENSOGAG00000032295   Transcript: ENSOGAT00000029705
Sequence length 1509
Comment pep:known_by_projection scaffold:OtoGar3:GL873556.1:650206:675743:1 gene:ENSOGAG00000032295 transcript:ENSOGAT00000029705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARAALLSQLLLWSLALAAGAGGGAAPRELSQPADIHAYQQQAPALFSAPVGGSQEQW
HSLQKWLGRLEAVVMELREQNQDLQVRVRRLEGCKCHPASPQCWGLGRAWPEGAHWEPDA
CTACTCRNGTAHCVPQTHLPHCCGCSHNGQTYGNGETFSPDPCTTCHCLAGTVQCQQPSC
SELNCLDSYTPPGECCPVCRPGCTEGVSRREHGQEWTSPGDPCQICQCLVGRIQCRQRDC
TSLCPYPARPLPGTCCPVCDGCFLNGREHRSGEPVGSKDPCLHCRCANGSVQCEPLPCPP
VPCRHPGRIPGQCCPVCDGCQYRGHQYQSQEAFRLQESGRCLRCSCQAGEVSCEEQECPV
APCLPPTSGPQLCRACVLDGEEFAEGVQWEPDGQPCTSCSCQDGEPVCRAVLCPPAPCQH
STQPPGACCPSCESCTYHGQVYANGQNFTDIDSACHTCHCKDGTVKCSLINCPPTTCARP
QSGPSQCCPRCPDCILEKQVFVDGENFSHPGDPCKECQCQEGHAHCRPRACPRPLCAHPL
PGTCCKNDCSGCAFGGKEYPNGADFPHPTDPCRLCRCLSGNVQCLARRCRPLPCLEPLLL
PGECCPQCPGKSITPRGGAVPAHHQEHISPPGEPCRRCFCLDGAVSCQRLPCPPTRCAHP
RQGPCCPSCDGCLYQGKEFASGERFPSPTAACHLCLCWEGSVSCERRACAPTQCPFPARD
DCCPACDGCEYLGESYLSNQEFLDPQEPCNLCTCLGGFVTCRRRPCEPLGCSHPLTPSGH
CCPTCQGCLYHGVTAASGETLPDPRDPACSLCTCQEGSMHCQKKPCPPALCPHPSPGPCF
CPVCHSCLSQGQEYQDGEEFEGPAGSCERCHCQAGQVSCVRLRCPPLPCLLQVTEQGSCC
PRCRGCLVHGVEHREGSSWVSPDSPCSSCVCHHGVVTCAHIQCVSSCAQPHQGPNDCCPR
CSDCEHQGRKYEPGESFQPGLDPCEVCLCELQPGGSPSLRCHRRQCPSLVGCPPSQLLPP
GPQHCCPTCAQALSNCSDDLLRSEIVSPDPCYTCQCQDLTWLCTHRACPELSCPLLEHHT
PPGSCCPICQAPTQSCVHQGREVASGERWAADACTSCSCVAGTVRCQSQRCQPLSCGPDQ
APALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCRYVLAKDCRSGDFSVHVI
NDNRGRIGVSWTQEVAVLLGDVKVQLLQGRVVTVDGRPVALPFLQEPLLYVELQGRAVIL
HAQPGLQVLWDGQSQVEVRVPGSYRGQTCGLCGNFNGFAQDDLQGPEGLLLPTEAAFGNS
WQVPEETRPSRPCSPGREVDPCRAAGYRVRREANARCGVLKSSPFSRCHAVVPPEPFFAA
CVYDLCACGPGSSADTCLCDALEAYASHCRQAGVTPAWRGPTLCAVGCPLDRGFVFDECG
PPCPRTCFNQHVPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPPVLIAGEKPLS
ALPRPSWEP
Download sequence
Identical sequences H0XLP7
ENSOGAP00000017037 ENSOGAP00000017037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]