SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017436 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017436
Domain Number 1 Region: 3879-4117
Classification Level Classification E-value
Superfamily Plakin repeat 1.48e-87
Family Plakin repeat 0.0000000246
Further Details:      
 
Domain Number 2 Region: 3300-3538
Classification Level Classification E-value
Superfamily Plakin repeat 5.62e-87
Family Plakin repeat 0.0000000615
Further Details:      
 
Domain Number 3 Region: 33-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-87
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 4 Region: 2641-2881
Classification Level Classification E-value
Superfamily Plakin repeat 6.8e-86
Family Plakin repeat 0.0000000615
Further Details:      
 
Domain Number 5 Region: 2969-3208
Classification Level Classification E-value
Superfamily Plakin repeat 2.09e-77
Family Plakin repeat 0.000000392
Further Details:      
 
Domain Number 6 Region: 3637-3874
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-77
Family Plakin repeat 0.000000855
Further Details:      
 
Domain Number 7 Region: 4190-4231,4265-4459
Classification Level Classification E-value
Superfamily Plakin repeat 2.96e-70
Family Plakin repeat 0.000000294
Further Details:      
 
Domain Number 8 Region: 275-391
Classification Level Classification E-value
Superfamily Spectrin repeat 9.93e-24
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 9 Region: 1152-1337
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-21
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 10 Region: 618-720
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-16
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 4137-4195
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000732
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 12 Region: 524-617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000017
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 13 Region: 725-807
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000302
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000017436
Domain Number - Region: 1047-1151
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0104
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017436   Gene: ENSOGAG00000034616   Transcript: ENSOGAT00000027180
Sequence length 4541
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:945862:972845:1 gene:ENSOGAG00000034616 transcript:ENSOGAT00000027180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSGSLFPSLVVVGHVVTLAAVWHWCRGRQQAQDKQDERDRVQKKTFTKWVNKHLIKAQ
RHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNI
RNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRC
DNFTSSWRDGRLFNAIIHRHKPMLIDMNKVYRQSNLENLDQAFSVAERDLGVTRLLDPED
VDVPQPDEKSIITYVSSLYDAMPRVPDAQDGVRANELQLRWQEYRELVMLLLQWIRHHIA
AFEERKFPSSFEEIEILWCQFLKFKETELPAKEADKNRSKGVFQSLEAAVQAGQLKVPPG
YHPLDVEKEWGRLHVAILEREKQLRSEFERLECLQRIVSKLQMEAGLCEEQLNQADALLQ
SDVRLLTAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHER
LVAIRTEYNLRLKAGVTAPVAQVTQVTLQSVQRRPELEDSTLRYLQDLLAWVEENQRRVD
GAEWGVDLPSVEAQLGGHRGLHQSIEEFRAKIERARSDEVQLSPATRAAYRDCLGRLDLH
YAKLLNSSKARLRSLESLHNFVVAATKELMWLSEKEEEEVGFDWSERNTNMAAKKESYSA
LMRELELKEKKIKDIQNTADRLLRDDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKE
NTAYFQFFSDVREAEEQLQKLQDTLRRKYSCDRSITVTRLEDLLQDVQDEKEQLNEYKGH
LSGLAKRAKAIVQLKPRNPAHPVRGRVPLLAVCDYKQVEVTVHKGDECQLVGPAQPSHWK
VLSSSGSEAAVPSVCFFVPPPNQEAQEAISRLEAQHQAVVVLWHQLHVDMRSLLAWQNLS
RDTQLIRSWSLATFRMLKPEEQRQALRSLELHYQAFLRDSQDAGGFGPEDRLIAEREYAS
CSQHYQQLLQSLEQGEQEESRCQRCISELKNIRLQLEAWETRTVHRLRLPLDKEPARECA
QRITEQQKAQAELEGLGKGVTQLSVEAEKIFTLPKPSPAAPTLRSELELTLGKLEQVRSL
SAIYLEKLKTISLVIRSTQGAEEVLKAYEEQLKEAQAVPATPSELEATKASLKKLRAQAE
AQQPVFDAVRDELRGAQEVGERLQQQHSERDVEVERWRERVTQLVERWQAVLAQIEVRQR
ELEQLGRQLRYYRESADPLGTWLQDARQRQEQIQAMPLADSRAVREQLRQEKALLEEIER
HGEKVEECQRFAKQYINAIKDYELQLVTYKVQLEPVASPAKKPKVQSGSESVIQEYVDLR
TRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHA
KAKAQAEQEAQELQQRMQEEAVRREEAAVDAQQQKRSIQEELQHVRQSSEAEIQAKARQV
EAAERSRLRIEEEIRVVRLQLEATERQRSGAEGELQALRARAEEAEAQKRQAQEEAERLR
KQVQDESQRKRQAEVELALRVKAEAEAAREKQRALQALEELRLQAEEADRRLRQAEAERA
RQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREETERLAQQQAEA
ERAREEAERELERWQLKANEALRLRLQAEEVAQQKTLAQAEAEKQKEEAEREARRRGKAE
EQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELTRLQ
REVAAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEASRFRELA
EEAARLRALAEEAKRQRQLAEEDATRQRAEAERVLAEKLAAISEATRLKTEAEIALKEKE
AENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASESELERQKGLVEDTLRQR
RQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKEQAELEATRQRQLAAEEE
QRRREAEERVQKSLAAEEEAARQRRAALEEVERLKAKVEEARRLRERAEQESARQLQLAQ
EAAQKRLQAEEKAHAFAVQQKEEELQQTLQQEQSMLERLRCEAEAARRAAEEAEAAREQA
EREVAQSRRQVEDAERQKQLAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALRQK
QAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKHLLDEELQRLKAEATEAT
RQRSQVEEELFSLRVQMEELGKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEA
ARLSVAAQEAARLRQLAEEDLAQQRTLAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQ
EQARRLQEDKEQMAQQLEQETQGFQRTLEAERQRQLEMSAEAERLKLRVAEMSRAQARAE
EDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDRDAERLREAIAELEREKE
KLKQEAKLLQLKSEEMQMVQQEQLLQETQALQQSFLSEKDSLLQREHFIEQEKAKLEQLF
QGEVAKAQQLLEEQRRQQQQMEQERQQLVASMEEARRRQREAEEGVRQQQEELQRLEQQR
QHQEKLLAEENQRLRERLQRLEEEHRAALAHSEEITASKTLPNGRDAHDGPTVEVEPEYS
FDGLRQKVPAQRLQEAGILSTEELQRLAQGHTTVAELAGREDVRQYLQGRSCIAGLLLKP
TNEKLSVYMALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHH
KLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGIRLLEAQIATGGIIDPVHSHRVP
VDVAYQRGYFDEEMNRILVDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLCLLPLT
DKAAKGRELVYTDSEARDVFEKATVSAPFGKFQGKTVTIWELINSEYFTAEQRRDLLRQF
RTGRVTVEKVIKIVITVLEEQQQKGQLYFEGLRTLVPAAELLESRIIDHDLYCQLQRGER
SVREVAEVDAVRQALRGANVIAGVWLEEAGQKLSIYEALKKGLLQPDVALPLLEAQAGTG
HIIDPATSSRLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYTGQSVALFQALKKGLL
PREQGLRLLDAQLSTGGIIDPSKSHRVPLDVAYARGYLDEETNRALLAPKDDSKTYHDPS
TQEPVTYRHLQQQCRPDQLTGLNLLPVSEKAARDRQKELYSELQARETFEKTAVEVPVGG
FKGKTVTIWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILITIIEEVETQRQERLSF
SGLRAPVPASELLAAGVLSRAQFEQLKDGKTTVKDLSEVGSVRTLLQGSGCLAGIYLEDS
KEKVTIYEAMRRGLLRPSTAALLLEAQAATGFLLDPVRNQRLYVHEAVKAGIVGPELHEK
LLSAEKAVTGYKDPYSGSTISLFQAMKKGLVLRDHGIRLLEAQIATGGIIDPVHSHRVPV
DVAYQRGYLDEEMNRVLADSSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKG
AEKAEVVETTQVYTEEETRKAFEETQIDIPGGGGHDGATMTLWEVMQSDMIPAEQRARLM
ADFQAGRVTKERMIIIIIEIIEKTEIVRQQNLASYDYIRRRLTAEDLYEARIISLETYNL
LREGTKNLREVLEAESAWRYLYGTGCVAGIYLPGSRQTLTVYQALKKGLLSAEVARLLLE
AQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQA
MKKELIPAEEALRLLDAQLATGGIVDPHLGFHLPLEVACQRGYLNKDTHDQLSEPSDVRS
YVDPSTDERLSYTQLLRRCRQDDKSGQLLLPLSDARKLTFRGLRKQITVEELVRSQVMDE
ATALQLQEGLASIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFE
LLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISL
FQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSD
DTKGFFDPNTEENLTYLQLMERCITDPQTGLRLLPLKEKKRERKTSSKSSVRKRRVVIVD
PETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDI
DEAIAKNLIDRSALDQYRAGTLSITEFADMLSGNASGFRSRSSSVGSSSSYSSPSVTRTP
LASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPST
GERCPVTEAVNKGLVDRIMVDRINLAQKAFSGFEDPRTKTKMSAAQALKKGWLYYEAGQR
FLEVQYLTGGLIEPDAPGRVSLDEALQRGTVDNRTAQKLRDVSAYSKYLTCPKTKLKISY
KDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSF
DATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA
Download sequence
Identical sequences H0XMU5
ENSOGAP00000017436 ENSOGAP00000017436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]