SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019815 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019815
Domain Number 1 Region: 206-452
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.77e-87
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-17
Family Hepsin, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019815   Gene: ENSOGAG00000026392   Transcript: ENSOGAT00000024289
Sequence length 455
Comment pep:known_by_projection scaffold:OtoGar3:GL873605.1:5454170:5463600:-1 gene:ENSOGAG00000026392 transcript:ENSOGAT00000024289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRLMLDDHAPMEAQYPEEGPRPGIFTAELGDQQQPISLAGCWHSMQRGCAVLGALGLLAG
AGVGSWLIVLYLWPAASQPTPGTLQDEEMPLGCSEASGEEALLPTLPRPVSFRVDRDDFL
LEVQVRAQSDWLLVCNEGWSPALGVQICQSLGHLRMTYYKGVNLTDHKLNSSQRFAQLSS
SPGGFLEEIRQPRNNCTSGQIVSLKCSECGARPLASRIVGGQAVAPGRWPWQASVALGFR
HMCGASVLAPDWVVTAAHCMYSYRLSRLSSWRVHAGLVSHSAIRPYQGAMVERIIPHPFY
STQNHDYDVALLWLRTPLNFSDTVGAVCLPALEQQFPRGSQCWVSGWGHTDPSHTHSSDM
LQDTVVPLLSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDKWHLV
GVVSWGRGCAEPNHPGVYAKVAEFLDWIHETAQVS
Download sequence
Identical sequences H0XUM3
ENSOGAP00000019815 ENSOGAP00000019815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]