SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021208 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021208
Domain Number 1 Region: 240-333
Classification Level Classification E-value
Superfamily TAFH domain-like 5.62e-36
Family TAFH domain-like 0.00000281
Further Details:      
 
Domain Number 2 Region: 526-573
Classification Level Classification E-value
Superfamily Histone-fold 2.68e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021208   Gene: ENSOGAG00000024820   Transcript: ENSOGAT00000029078
Sequence length 741
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:21073284:21155891:-1 gene:ENSOGAG00000024820 transcript:ENSOGAT00000029078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTVVQAAPPPTQTLAASGPASTAASMIIGPTMQGTLPSPAGVPPPAPGTPTGLPKGTAGA
PTQSLPRTPAATTGGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLM
IPQQALAQMQAQAHAQAQPQTTMTPRPATPTNAPPVQISTVQAPGTPIIARQVTPTAIIK
QVSQAQTTVQPTSTLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATATSTA
ATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKMEAEDFTSRLYREL
NSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPASQATTALTAVVLSGSVQRTA
GKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQSPKPGALIRPPQVALTQTPMV
ALRQPHSRIMLTAPQQIQLNQLQPVPVVKPPVLPGAKALSTVSAQAAAAQKNKLKEPGGG
SFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLPAPLQRRILEIG
KKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQSSDVRAQLKF
FEQLDQMEKQRKDEQEREILMRAAKAISRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDA
NLTALAAIGPRKKRKVDGPGPGTGTEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLI
FCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences H0XYL5
ENSOGAP00000021208 ENSOGAP00000021208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]