SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD001517 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD001517
Domain Number 1 Region: 27-123
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000355
Family Ran-binding domain 0.037
Further Details:      
 
Weak hits

Sequence:  OsIBCD001517
Domain Number - Region: 299-501
Classification Level Classification E-value
Superfamily ARM repeat 0.0147
Family MIF4G domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD001517
Sequence length 792
Comment 792
Sequence
MGEQERREAEGGGGGGEAAAANTSGMQRVKVYRLTDGGKWDDRGTGHVNIDFLEDSKELG
LTVLDEEDNETLLMHNITSEDIYRKQEDTIISWRDPEVATELALSFQEAAGCSYIWDNIC
DIQRNIQFNNLGGFIADESFRSVNGELRELPPVELSNLPLILKTILEGGITDQMRVAELI
TQDREFFPKLLDIFRICEDLENLDDLHMIFKLVRGIILLNSSSIFDKIFSDEFILDIIGA
LEYDPDVPKVQKHRAFLKDHVVFKEAIPIKNVSVVSKIHQTYRIGYLKDVILPRVLDDGT
LASLNTMIHSNNAAVISLLKDDSCFIQELFARMRLSNISMESKRELVLFLHEFCTLSKSL
PLVQQLRLFRDLSGEGVFDIISDVLQSQDRKIVSAGTDVLILFLNQDPNLLRSYIVQQEG
NSLLGLLAQSSTAHHSNHKLSISYSFFQVKGMVTDFGEAMHCQFLEILRILMDSFTMSGA
HDDFLIRHVVKMNLFKPIIDAFVENGDRYNMLQSGVLELLEYIRKEGLKQLIIYANESFW
DQLMKFEHFGSIQAFRLKYQQYLESAETKLSANVPDIRKKAEERGLEKEEEDYFNEDSDE
EDSVRRTKHAQKQDGGAKLTNGSEADDVSSRPKCGGLVDYADDDDEDFNPPPKEPDRPEE
DDEPLTIAKLKRKLMNSKVDGKQSDGEFHKRQKIETRITSVKIGASTNLVSKRMDDLEKQ
EPRSPASSSSGSEANGVFGEHSVHSEEHQRSADNTEASRQAGGDCVNAMGNLSTEKSVNT
TNTNDSEPYSVR
Download sequence
Identical sequences OsIBCD001517 39946.BGIOSIBCE001664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]