SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD002680 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD002680
Domain Number 1 Region: 15-143
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-46
Family Necap1 N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD002680
Sequence length 332
Comment 332
Sequence
MSSTGEQSQAKAEAEEAVELVLFQVAECYVYLIPPRKTAASYRADEWNVNKWAWEGTLKV
VSKGEECIIKLEDKNTGELYARAFLREDEPHPVEPVIDSSRYFVLRVEENIDGRQRHAFI
GLGFRERPQAYDFQAALHDHMKYPCVHYLKHDMYSNVLPCNHSMAGDSKKTAEEMVQHYE
KSSSVDYSLKEGETLVLQLKNKESGAKIKSAFFEQGLNKLSFNEKANSKEAPVSLKLPPP
PPSPVSPTDSGIAASPFKAEFPSQDQPAADTGADTTPFKAEFPSSHEQPAADNVASSPPP
KAEAAPQEQPTAAEKAPQESVDDDFGDFQAAG
Download sequence
Identical sequences OsIBCD002680 39946.BGIOSIBCE002756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]