SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD003173 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD003173
Domain Number - Region: 41-103
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0759
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003173
Sequence length 150
Comment 150
Sequence
MGSIGNGRNGSEVGIQIPAMGNKEVLERPAIPRWPRLGVVMVATRAVALVMAVLSMALMI
SAKQRGSLKIFGIEIPLYANWSFSDSLEYLVGMSAVSAAYCLAQLLLTAHKAVKNAPVVQ
SRNYAWLLFTGDQDGGVAGTGRVGGVRWHR
Download sequence
Identical sequences A0A0E0FSJ8
39946.BGIOSIBCE003472 ONIVA01G33760.3 OsIBCD003173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]