SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD004723 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004723
Domain Number 1 Region: 258-374
Classification Level Classification E-value
Superfamily Bet v1-like 4.81e-30
Family STAR domain 0.0082
Further Details:      
 
Domain Number 2 Region: 69-190
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000186
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004723
Sequence length 722
Comment 722
Sequence
MMLSSSASRREAGGGGAASSTKSGELSLSKVASVAIRESSGSGGISKSSELLPRAGTMAA
AREAAAAAVHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLID
GNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITRYISIYMTRFNSQMGAYDIEDALAWK
KNIELIIDQQQENMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEERPMLIRRTTIG
NGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLV
EEVDGHTAILYHKLQLHWLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRA
FIESLREYFSQTDETHITPRIPVMENMVDTSAVQKDDKKSTEEVDSKTKTPDRGQADSKN
MGIIDEETDEDEDYQVPEANIEEDPNKDAKRADEPPEKIDLSCFSGILRCDADEKSRNCW
TVPDSKLFKVRSKNFPHDKSKIPAASYLMELAAIDWFKDSKRMDNVGRQKGCVAQVAAEK
GMHTFVANIQIPGSTHYSLVMYFVTKSLKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSW
IVRQSVGSTPCLLGKAVDCSYVRGAGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAF
LIQANTYEELPEQVIGAARLAHVEPAAAIVPQDLTPPPPALADDDNAAASSSEDDHLSKK
TN
Download sequence
Identical sequences 39946.BGIOSIBCE005240 OsIBCD004723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]