SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD005156 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD005156
Domain Number 1 Region: 2342-2634
Classification Level Classification E-value
Superfamily BEACH domain 9.16e-123
Family BEACH domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 2737-3001
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.65e-39
Family WD40-repeat 0.009
Further Details:      
 
Domain Number 3 Region: 2176-2227,2268-2320
Classification Level Classification E-value
Superfamily PH domain-like 4.12e-19
Family PreBEACH PH-like domain 0.0075
Further Details:      
 
Domain Number 4 Region: 986-1114,1168-1227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000763
Family Pentraxin (pentaxin) 0.064
Further Details:      
 
Domain Number 5 Region: 838-948,1449-1531
Classification Level Classification E-value
Superfamily ARM repeat 0.00000237
Family Armadillo repeat 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD005156
Sequence length 3017
Comment 3017
Sequence
MNIVQGVADLLRKSAAASSGVGGGGGGGGGGGDVGGAGGSPSSAPDRLAAAPSPRVRFSD
SGVEGVLNMLWQKYENAIDKAEKKESLQIFIMHFVQAFKKWEPQYTEQSVDQEPISDDTV
LGCSRGHPSEIILILVQEVSQITSFITESSSCSESSPNISEQSSDLVLSSEGLNILECLT
IVTRSVHNCRVFSYYGGVQKVTALLKAAVVKLKTLTSLLAADEQLSNKAIDNMKMMQKIL
VHIVTIISNFMNLEPTATRLTQFVNTTGQTLSNEFLATVTPISAKSAVHDTNWQQKAIVA
VMEAGGVNCSLGSVRVENERELLRVIRRLNLKEQWTDVLLHFITLHALRSTISQHARAQN
HFRSIGGLEVLLDGLGLPSSKLSVSKYSFVPSDERSGILQLQILSLEILREAVYPDAHIF
LGFHQQKALDSRVQNCKLEESTGISLTSESFASPIDILDTTEWTEYSVKLSIALCSFLLP
PNEIRNSSGAVDSQVSLSISVAYCEQCARWIIKDFGKYPTALYSLHIQEAGSKGLNQADV
NILQAEAISFLEFAATINENTNNLPECSALLDVLECCTYDPGLAGTILKSFHVILQLATE
QTMSSFKSLDVLTRVLKVACLQAQHLRKLSHPGDGLSGNVFQSENVQMSSSDEKIKSTIA
CVELAFNLFKEYTTISELGRILVLHNANCIECLFDLFQEENLRKNVLEQVLDLFRLPSAS
AQDHTAKLQLCSKYLEAFTRAKEKEDFAELSIDLLVNMREIIMIDRMYYQNLFRNGECFL
HIVSLLNGTFDEAVGEQLVLNVLQTLTVLLAENDVSKASFRMLVGVGYQTLQSLLLDFCK
WLPSQKLLDAILGMLVDGTFDKNEETTIKNEDVIILFLNVLQKSSTALQHYGLVVLQQLL
KGSITNRSSCFKAGFLSFLLDWFSVEETDDTVIKIAELIQIIGGHSICGKDIRKMFALLR
DEKIGVKQKRNSLLLTSLSHMLKEKGPEAFFEFSGHDSGIEIKSPVQWPYNKGLSFCCWL
RVESFLENSMMGLFSFFTESGKGCLAMLGKDALIFESISQKHQCVLSPLSLPTKQWIFLS
VTHSVGRAFSTGSQLRCYVDGGQISNQKCRISDTIQFLVQLAEIPGGKSYGLWMKMKQGE
GHKAYEPLEFSDGGPSKVESPSMWAKVNEVMTRCSIGTDLMPIGEEPTSLGFESTSAFVG
QMGPVYAFSDALSSEQIKGIYNLGPSYMYSFLGDQNLLMNVDTLYKGILDGKDGISSKMI
FGLNAQASNNRTLFNVSAALDGLDKSKFEATIMGGTKLCSRRLLQEIIYCVGGVSVFFPL
LIHFDDAVIHSREPAIGDELAGQVVELVASVLDGNVANQQQMHLLSGFSILGFLFQSVSP
QLLNFKTLSSLKYMLNVLKNCEKTDLRSSKTSLHPVTKEVIAEGPNIEEIRKIRLLLLSL
AEMSIKLKVSQHDITTLVSFFERSQDVACIEDVLHMIIRALSHNSLLSSFLEKVNPLGGC
YIFINLLKREFEPIRLLGLQFLGELLVGVPSEKKGPKFFGLPVGRPRSISENLRKGMTAA
PQLFFYSISERLFKFPLSDHLRATLFDVLLGGASPKQVLQKRSQSEVSKDSAISSASLSP
FAVPQILEYGWSSWLETSVKLDVFRDYKSSSEAEDNTYETNELILVRNMYSLVLTYCLCS
MKGGWHQLEDTTNFLLLKIEQLIHELFVDQIGIKLLFPSPGLSAQSSSDDSLIEDINTSV
VEILNAEGSGQLTSFPWSNSTYTDGDKLSDDWWSFYDKIWTLLCNLNGRGQNRLTPKGSN
AAVPSIGQRARGLVESLNIPAAEMAAVVVTGGIGSALSGKANKNADKAMMLRGERFPRII
FHLIILYLCKAGLENLSKSLLRGRSQYGGLDDGARSHVMSPLIFEILVQGKSLLATNMLA
RDDSTEVNSNKDSGYVLNFVQKDRVLAAAADEVKYMKDAKADRLRQLQELHSKIDESLIE
DIEQLQSFEDDIQFAKSAAISVDDSRKAALQLAFDEDQQIIADKWIHIFRALSEERGPWS
ANPFPNSTVTYWKLDKTEDKWRRRLKLKRNYKFDERLCQPPSKSSNESNASSVNPSVSAK
IPEKMKHLLLKGVRGITGDVSSEPCEDNNDMSEPSQNTLSETQGSSDAADSSGYSTSVQN
RKEPVSTGGDDDYAAILSSVQCVLVTPKRKLAGQLTITQKALHFSFEFLVEGTGGTSVFN
RYQEKDSDPKNDLGGAEKLKGSLDGGRGNATESGDALMKNTSNKIKHHRRWKISRIKAVH
WTRYLLQYTATEIFFDDANAPVFLNFSSQNDAKNIGSLLVSLRNDALFPKGSTKDKNSVI
SFVDRKVALEMAESSRESWRRREMSNFEYLMILNTLAGRSYNDLTQYPIFPWILSDYSSE
KIDFNKSSSFRDLSKPVGALDAKRFKVFEERYLNFCDPDIPSFYYGSHYSSMGIVLYYLL
RLEPFTALHRNLQGGKFDHADRLFQSIESTYRNCLSNTSDVKELIPEFFYMPEFLENSNS
YHLGVKQDGEPLGNVGLPPWAKGCPEEFIHINREALESEYVSSNLHHWIDLIFGYKQRGK
PAVEAANIFYYLTYEGAVDLENMDDMLQKSAIEDQIANFGQTPIQIFRKKHPRRGPPIPI
AHPLYFAPQSITVTSVVPSSSSSSSPVLFVSLLDSNIVVMNEGLVLSVKLWLTTQLQSGG
NFTFSGSLEPFFGIGSDVISPRKISTSLAENVDFGRQCLTAVQIHGDNYLILCGNWENSF
QIISLGDGRIVQSVRQHKDVVSCVAVSSDGSVIATGSYDTTVMIWHAFRGKSADKKSRNA
NYDLSTKDHVIIESPYHILCGHDDIITCLFVSTELDIVISGSKDGTCIFHTLREGKYVRS
IRHPSGAGLSKLVASQHGRLVFYSDSDLSLHMYSINGKHIASSEANGRLNCMELSCCGEF
VVCAGDHGQIVLRSMHSLDVVWRYEGAGKTITSLVVTPEECFLAGTKDGSLIVFSIENPL
IRKGTVQRNKIKSSVGG
Download sequence
Identical sequences OsIBCD005156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]