SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD007309 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007309
Domain Number 1 Region: 7-222,253-277
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.38e-41
Family BAR domain 0.013
Further Details:      
 
Domain Number 2 Region: 426-554
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.58e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00034
Further Details:      
 
Domain Number 3 Region: 255-295,329-400
Classification Level Classification E-value
Superfamily PH domain-like 6.4e-22
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 4 Region: 632-705
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-19
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007309
Sequence length 827
Comment 827
Sequence
MAAFTKLEDSPMFRKQVNSMEQLSDELKQRCSNLHKGCKRFIIADNLSFRGSLDEGYAGD
LTFADALEAFGAGQDDPVSVAIGGPVMSKFTTAFRELGTYKELLRSQVDHMLSERLMQFI
DVDLHGVKDCRQRLDRATVGYDQAREKFVSVRKGTRAEVVTGLEEDLHNAKSAFERCRFN
LVLTYAQQSKEMAINEQDKLAKRIQEYRTQEEIANLRMASNVDTSTSGDGIHVVGLQSYK
KIEALMQSTANGEVQIIKQGYLFKRSENSREWKRRFFVLDSHGTLFYYGNKGQSQGAASQ
QTAGEGTGVFSRFRFLNQKAPTQGDNALSCHKIDLRTSTIKIDAEENDLRFCFRVISPMK
AYTLQAESGADQKDWIEKVTGVIASLLNLPFPRQVSYGNLEAEHHGSANSVDSHSLEENK
SPEGHDDIFNHLRNIPGNDSCAECRSPDPDWASLNLGILICIECSGAHRNLGVHISKVRS
LRLDVKVWEPVIMDLFRELGNDYTNSIWEAMLPKEDQGINEFNDAILFIEKPKPTDAFSI
KERYIQTKYVDKLLIAKDTNQITIDILEAIRTNDVRAAYHILVLADVSPNMIYDELNNDV
HHDPSVTDGKLFDPASCDVKDDSGKPEGCLQGCSLLHIACQYGHSIMAELLLLFGADINK
QDFHGRTPLHHCVRRKNDALTKHLLKRGARTTIKDGGGLTALERRMELGAITDEDLFILF
VRDRRMEGQTPRSSASLRPGVQMVFVSGTEEMTTQLKAPERNGHGMVARSWSWAPGRRTC
KLQEHMKERAMKDGQATLTASCNACKAANQSLRIYSVSLCMIAIVPR
Download sequence
Identical sequences B8AFS0
39946.BGIOSIBCE007921 OsIBCD007309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]