SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD007584 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007584
Domain Number 1 Region: 177-559
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.35e-90
Family Regulator of chromosome condensation RCC1 0.00037
Further Details:      
 
Domain Number 2 Region: 561-631
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 15-89
Classification Level Classification E-value
Superfamily PH domain-like 0.00000234
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007584
Sequence length 988
Comment 988
Sequence
MAGSFEGRSPAARGVEQALVALKKGAHLLKCGKRGKPKLCPFRLSSAYLLNARNFDEEDE
KMLMWYSKDREKRLNLSSVSSVVLGHKTVHSIYGSPRLMQKNVLQSNLDFSEPFFSPRQR
TWSDLDYYMEKVTPDVVNRVKHSCRDIKVADKLNEQIITQLPKQKSSEGLHVAYGATSLK
DIFVWGEVPGNVLDHGDVSKANVSLPRLLNTTHIIDVQSVACGEKHAAIVTKQGEVFSWG
VDNGGRLGHKVSVSVSDPKIIESLASTRVKAIAFGAKHTCAVSISGELYEWGEGTHCLGL
WGDQYQRSQWFPHKLFGPLDGISILKIACGHWHTAIISSAGQIFTYGDGTFGVLGHGDTL
TVARPKQVESLKGVRAKAIACGPWHTAAIVERMGTVKSNAPSGKLFTWGDADRGKLGHAD
KKMKLVPTCVEPLNDFDFAQVSCAKAQTIVLTITGVVFTIGSKEHGRLGNPLSEDTSICL
IEGPLKTEFVREISSGSSHIAVLTMNGKVFTWGKGTEGQLGLGDYVDRSYPTLVEALEDK
QVHSIACGFNFTMAICLHRPLSSKDQSVCSNCQLTFGFTRKKHNCYNCGSMFCNSCSNNK
VSRAALAPDRSKRYRVCDACFSQMQKVEEHSKLDPQQKIQKDEVCPIEIRSYTPKLARIF
KEANAIMEKMASAQSPHQRSQNLAVPDHVRTLRWGLVECPSQFRCVRESIPYCSTLNKQT
VSGSIVRVMNETMAPKPASSLLKSANDSKAELDLMENILLEEVKQLQEQVTTLAKQCRQR
SLKVQLYKRKVEETWLIAKDEAAKCKAAKDIIKVLIDQHDFLSKNLLAGEKLDNSRIMPS
HIASAKSLKAELPDPPDKNVFTSEFQQSKSNRDHHNSRQVDRECTQPSIASMADYSVMHQ
NCRRTSNGSTRCTEGTDATTAPTDSNGVIEQIERGVYATVVTSPGGKKCIKRIRFSRKHF
GEDQAQKWWEANESMIFGKYSSMEQTVG
Download sequence
Identical sequences B8AGQ9
OsIBCD007584 39946.BGIOSIBCE008233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]