SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD009479 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD009479
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily PH domain-like 0.0443
Family VPS36 N-terminal domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009479
Sequence length 239
Comment 239
Sequence
MAPGLQRFTDIAGDGGPRLDAASGEELLRMDRAASVALGRRAPEPPGTLFVTTRRVIWLS
ETEKGQGYAVDFLAITLHAVSRDLEAYPSPCIYTQIDAEDGSDEEAGGSDFEANGDLQLT
KVSEMRIILSDPVLDPLQSFSVDALFDVFCHCAELNPDPNAVRNEENGWSGGENMAEGGW
IHGDEDMIDGNDLEAHMFFTNLIGQNGVHDLGRSVRELQIDDQRFEDAEEEDEIQENGH
Download sequence
Identical sequences 39946.BGIOSIBCE010366 OsIBCD009479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]