SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD009515 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009515
Domain Number 1 Region: 210-405
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-30
Family BCR-homology GTPase activation domain (BH-domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009515
Sequence length 847
Comment 847
Sequence
MSASEFRIPYQQVSSSQTTENAGQFKICRCGEGDPNTNTSETGDKSPTSCPNCQVLKSGH
LLLSSKGIGWTTWKKRWFILTRASLVFFRSDPNAPPRGNEPIVTLGGIDLNNSGSVVVKE
DKKLLTVLFPDGRDGRTFTLKAESTEELNEWRSALENALAQAPVVANTVGQNPIFSTDIA
EPAEAPAEQSDNKSIIGRPAEFALVDADGSPAFLEKALKFIEDYGVKVEGILRQSADVEE
VKRRVRDYEKGKNEFSPEEDAHVIGDCIKYVLREMPSSPVPAPCCTALVGAYRTDKTRRL
DAMNRVIYEVFPEPNRQLLQRTLKMMQIVESHKAVNRMSQSALAACMAPLLLRPLLLGEC
EIDSDFSMAGDGSFQLLQAAAAANHAQAIVIIMLEEYDQIFDDLEDGSYSSDAYTESEDG
DFDKEYSTDNDGPEEDDSYDSGEDNIEEGMDDDTEHSSGGSECDNNIKTSVSDDKVKSNN
SGTASNGNDQGLQPPKKAARTGHGAVREDTCQIESNDPSNRKQELYESNGSTDQIEKLNV
RSSSARAKFMEKSSSSRNKSKKTLWGRTSARKNLSAEEIDYCSDDETLIEKLENSKTDLQ
SKITKEAKENSILQASLERRKVELHKRRLALEKEVENLRDQLQKERNLRVSLESGLMNLR
RGQASFPSTIDNKTKADLEEVATAEADILNLKQKGSDLRGQLNNQVQMSSASLCDSCNKR
LLNTDKLTEGEQSTTSSNVGPNSISDMVSATHMAQRMLISKGEIVKDGQDPLASKWNLAQ
KQYSNNPLLGRLGSRTEDSGAPSALAKLTNRLNFLKERRAILASEMQNLDLARPPGPPAP
APKRDST
Download sequence
Identical sequences 39946.BGIOSIBCE010414 OsIBCD009515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]