SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD011473 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011473
Domain Number 1 Region: 30-86
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000516
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Weak hits

Sequence:  OsIBCD011473
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily BAS1536-like 0.0419
Family BAS1536-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011473
Sequence length 462
Comment 462
Sequence
MATNGSSPRARETESSLEKVKRQLSSGSGRYLLQGPLLKRSETLRKWNERWVILDPTSGK
MEYKIRRNETAIKGTIIFDASSTITLSPVNFHATQLVLQAHKEAVNSLAGNGSPATLGTV
ATAVANANATALEATKEIEAAMKVSMRAALGLGANNPKEGQLDDLTIMKETLRVKDEELQ
NLAKDIRARDATIKEIANKLTETAEAAEAAASAAHTMDEQRRLLCSEIERLRQAMERQME
QSMLKLRQSEEKVISLSKEKDQLLKERDAALQEAHMWRTELGKAREQAVIQEATIARADE
KVRASEADAAARIKEAAEKLHAVEKEKEELLSLVGILQSQVQREQSSTKQVCEERSESCS
GTDNSPPLTKHVDASDDDVDKACVSDSRSVLVSNDNTEVQLAVDGVDIRPIGDAEWGSFQ
QSEALIADVREVSPESEGGSLDIPVVNPPPVSDHIQGGATHP
Download sequence
Identical sequences 39946.BGIOSIBCE012393 OsIBCD011473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]