SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD014857 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD014857
Domain Number - Region: 360-403
Classification Level Classification E-value
Superfamily PH domain-like 0.0525
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014857
Sequence length 423
Comment 423
Sequence
MELDRSLIACEEPPSEPMDLLSSAWCSSAIQVLQTGSMDCSMALVENPVMAPENDRRDLL
PKNDRSLVVDSSGFSTTQWKYDDLKSWIWLQKAIHPELDYDLKKKWLPRKMAPWSGISLK
KWVKERKQKRKEEARLHKAEVHAAVSVAGVAAALAAIAAESSTPAATMKETAVASAAALV
AAQCAKVAEAAGATRDQVAAAVNAAVAATDASNVITLTAAAATSLRGAAALRGRRSSGGG
GSQNERMDHASSALSQDDLDFDFNYARSKAALAKGDEMFVAMPDGKWKLHTVSAATSKGG
KVVMRIKKMNLVMAFSNAKESKKPNAQVDRATAIPVHLLTLRENDRAGVIHDVQPCAPEK
PSRDEDATYPIEVTTSKGKVELRADDYGVYKRWVTALTHMLAAPTAICKAHELPPPPPPH
RRN
Download sequence
Identical sequences OsIBCD014857 39946.BGIOSIBCE015764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]