SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD015211 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015211
Domain Number 1 Region: 2102-2388
Classification Level Classification E-value
Superfamily BEACH domain 7.98e-126
Family BEACH domain 0.00000000975
Further Details:      
 
Domain Number 2 Region: 2510-2579,2614-2729,2768-2815
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.99e-30
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 1987-2087
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000184
Family PreBEACH PH-like domain 0.0027
Further Details:      
 
Domain Number 4 Region: 279-318,361-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000352
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015211
Sequence length 2841
Comment 2841
Sequence
MAEEPRESLDSSPEPPPPGQDSDEQFSAVPLADEVRAEGSELDPDTSAGTSVAVTPARSE
PSPPPPRRRRPRPLGVPPDAPQEVVRAVDDAIMVGGGAAAAAGVDRLHEMVSEEQGELPH
TVVDVLLGTMGGADGLDEVEDKTGTGAPPSIMFNSRAAVVAAELLPYLPCGDEPSPRTRM
AVGIHATLRACTRNRAMCSSSGLLPVLLDSAEKLLIGMGRASSWDGTPLLHCIQLLGGHS
LSVKDLHSWLGLVKKALGTSWATPLMLALEKAMGSEEARGPAATFEFDGESSGLLGPGDS
RWPFSNGYGFATWIYIESFSDTLSTATAAAAIAAAAAATSGKSSAMSAAAAASALAGEGT
THMPRLFSFLSSDNQGVEAYFHGQFLVVESGGGRGKKASLHFTYAFKPQRWYFVGLEHTN
KHGLLGKGDSELRLYVDGSLHESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCPL
FAEMGPIYIFREPIGPERMGRLASRGGDVLPSFGNGAGLPWRATNDHVKNMAEESFTLNQ
QIGGCLHLLYHPSLLNGRLCPDASPSGSAGTHRRPAEVLGLVHVSSRVRPAESLWPLAYG
GPMALLPLTISNVQMDSLEPMLGELSIATASLSAPIFRIISLAIQHPGNNEELCRTCSPE
ILSRVLHYQLQAFPKMEGGEGEAVTDEELVDAIVSLCQSQRNNHELKVQLFSTLLLDLKM
WSSCTYGLQKKLLSSLADMIFTEAACMRDANALQMLLDSCRRCYWAIREPNSIDNFALTG
TKRSLGEINALIDELLVVVELLLGSASSTAASDDVRCLIGFVVDCPQPNQVARVLHLIYR
LIVQPNISRANMFAQSFISCGGVDALLVLLQREAKAGNNSILDNSDALLSENDFLRNDDS
DTKAASGEAKSQDDQIQSVELEQHESILHEEHTELGSTSTNDVPCEILGSSIGRKLSSSE
NQLLKNLGGINFSITADNVRNNVYNVDKGDGIVVGIIHILGALVASGHLKFASRAANPNL
PGGLLTTVHEEGNTMSEDRVSLLLFALQKAFQAAPRRLMTVNVYMALISAAINVSSVDEN
LNLYDCGHRFEHIQLLLVLLRSLPYASRSFQSRAIQDLLFLACSHPENRTTMTSISEWPE
WILEVLIYNHEDVEATIHCAEWLSMVGGSSTGDQRIRREESLPILKRRLLGGLLDFSARE
LQVQTEVIAAAAAGVAAEGLSPEEAKTQAENAAHLSVALAENAIVILMLVEDHLRSQGQH
FCTSRSLDSAVPSASMVSSAASRSNSLCRSGNEPMDAGTSRRSSLSTDAGGLPLDVLTSM
ADSNGQISAAVMERLTSAAAAEPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGIPSK
SDTFGGGGSGWEFWKSVLEKDSNGTWVDLPLVKKSVAVLQALLLDDSGLGGGLGIGGGSG
PGMGVMTALYQLLDSDQPFLCMLRMTLVSMREDDNGEGDAFTGNISIKDVISEGLGHQAG
SMMPLDSNNRSSTRKPRSALLWSVLGPILNMPINESKRQRVLVASSILYSEVWHAIGRDR
SPLRKQFIELILPPFIAILRRWRPLLAGIHELTSSDGQNPLISDDRALAADALPIEAALS
MISPGWAAAFASPPVALALAMMAAGASGTEAIAPPRTLNRRDTSVPERKAAPKLQSFTSF
QKPIETAPNKHGSTPKDKAAVKAAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSAGD
IERAKRWNTSEAMSAAWMECLQSVDSKSVSGRDFSALSYKYVAILVSGFALARNLQRVEM
ERQTQADVLNRHRVSTGVRAWRHLLHCLTEMDRLYGPFGEPLCAPDRIFWKLDFTESSSR
MRRFMKRNHKGSDHLGAAADYEERKLSNVAQSNECNPEGTEPLVTDTLPSTAPIITAEAM
SVDDRNEDNEQLESDTTQSSVDDRLQQADQQSVKGSIDSRGSGISADRNLVRSTVIAPGY
VPSDADERIIVELPSSMVRPLKVVRGTFQVTSKRINFIIDESASESNMDDHASTSGQCDQ
QDKDRSWLISSLHQIYSRRYLLRRSALELFMDMEARKNAYRAIVHSKPPNLNDIFLATQR
AEQILKRTQLTERWANWEISNFEYLMELNTLAGRSYNDITQYPVFPWIIADYRSEILNLD
DPCTYRDLSKPIGALNPERLEKFQERYSTFEDPIIPKFHYGSHYSSAGTVLYYLFRVEPY
TTLSIQLQGGKFDHADRMFSDLSGTWDSVLEDMSDVKELVPEMFYLPEVFTNINSIDFGT
TQLGGKLDSVNLPPWAEDPVDFVHKHRKALESEHVSAHLHEWIDLIFGFKQRGKEAVMAN
NVFFYITYEGTVDIDKITDPVQRQAMQDQIAYFGQTPSQLLTIPHMKRKPLAEVLHLQTI
FRNPSELKSYLLPNPDRCNVPASTMFVSNDSIVVVDVNVPAAHVALHHWQPNTPDGQGTP
FLFHHGRNAANSTGGALMRIFKGSASSGEDYDFPRAIAFAASSIRSSAVVAVTCDKEIIT
GGHADGSVKLISPDGAKTIETATGHLAPVTCLALSHDSNYLVTGSRDTTVILWRIHQAGS
LHKKNAPEPPPTTPTTPRSPSVSNLTEIRRRRIEGPMHVLRGHLEEVTSCSVSPDLGLVV
SSSNMSGVLLHSLRTGRLIRKLNVAEAHAVCLSSQGVILVWNESKKRLSTFTVNGLPIAT
TVLSPFCGRVSCIEISTDGHFALMGTCSSSNYKCEDSTETGDHEPNEPNGKDGISKQAET
RQSVHVPSVCFVDLHKLKVFHTMELGKGQDVTAIALNKENTNLLLSTADKQLIVFTDPAL
SLKVVDQMLRLGWEGDGLLQS
Download sequence
Identical sequences OsIBCD015211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]