SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD016074 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016074
Domain Number 1 Region: 218-559
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.59e-77
Family Regulator of chromosome condensation RCC1 0.0014
Further Details:      
 
Domain Number 2 Region: 6-116
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-24
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 565-630
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.12e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  OsIBCD016074
Domain Number - Region: 729-771
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0392
Family Mitotic arrest deficient-like 1, Mad1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016074
Sequence length 1012
Comment 1012
Sequence
MADPVDIDKALIALKKGTQLLKYGRKGKPKFTPFRLSNDESTLIWVSNNKEKSLKLSSVS
RVLSGQRTLVFQRFLLPEKDHLSFSLIYNDGKRSLDLICKDKVEAEVWFAGLNVLISPGQ
HGSQHQHIDGIRNGALSFECGRDSSLSSSSAYTTDSFENKLSSANSAKDRSSGEFTYSER
TDVSDMQVKGASSDIRISVSSALSTSSHGSGDDSESFGDVYVWGEVMCDTTCRQGSDSNA
YSATAATDILVPKPLESNVMLDVSYVACGVKHAALVTRQAEVFTWGEECSGRLGHGAGTS
IFQPRLVESLSICNVETLPVGLQVVKLLSCGTWHTALRTSSGKLYTFGDGTFGVLGHGNR
ETISYPKEVESLKGLRTISVSCGVWHTAAVVEVIMAQSNTSSGKLFTWGDGDKYRLGHGD
RSSKLKPTCVPSLIDYNFHKAVCGHTLTIGLTTSGHIFTAGSSVYGQLGNPNNDGRYPRL
VEEKLGGGGVVEVVCGAYHVAVLTQSGEVYTWGKGANGRLGHGDIADRKTPTFVEALRDR
SVKRIACGSGFTAAICQHKSVSGMEQSQCSSCRQPFGFTRKRHNCYNCGLVHCHSCSSKK
ALRAALSPNPGKPYRVCDSCYLKLSKVLDSGIGHNKNNTPRIPGDSKADKMDSKGNRVAS
ANSSDMIKNLDVKAAKQTKKYDYPPQFPAILQLKDIPFIGAADQQPNDSTYSSPLLRLPN
LNSSSSLSSESFDILRDANELLKQEVQKLKEEVNSLRQQREQQDADLQKSEAKAHEAMTL
ASEEASKSKAAKDVIKSLTAQLKEMAERLPPASCDMKQTRQPYLPGGAVSPDTGRENQKR
YEPGSFQYPQTPTSVASARFNGFLAQAHQISEPNGNTMVPHDSRHENNGNTKEFPVAQQM
TNGGMTGYRPRTEDHDRRETERFQINLHGFNMRGSSSPSNQVEAEWIEQYEPGVYLTLVS
LRDGTKELKRVRFSRRRFGEHQAESWWNDNREKVYDKYNVRGTDRISSVMTA
Download sequence
Identical sequences B8ART6
39946.BGIOSIBCE017147 OsIBCD016074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]