SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD017399 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD017399
Domain Number - Region: 121-172
Classification Level Classification E-value
Superfamily PH domain-like 0.0574
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD017399
Sequence length 292
Comment 292
Sequence
MDLGKSASTSTTLKKLQEDGALPGREKTEREAGGTNPQPLLGRMVAIKDYVVCGFLPPPS
EFLLLVLNFYGLSLLHLNPNSIAFLSVFVHLCEAYIGVEPFLDLFPFYYELRWMEPNRVS
GCVGFRLRDGRKLGYVPFQCPSSRSKWRNRWFYLEIKDSNPVLVVPEEQPDKIPVWTAKP
PLTPSLQLFIDIIDDLRERGLSGYEVVADFVGLSSEVVERRTGQVMISGLTTASNIPAPL
CERGAGERDEAINVATSLKEKVVEEASDAATTSGGKVVTPENSLVISELICA
Download sequence
Identical sequences OsIBCD017399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]