SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD018408 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD018408
Domain Number - Region: 81-186
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.000759
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD018408
Sequence length 874
Comment 874
Sequence
MAPIMSGAAAAAGGTGGAVPLIKNATSASQMSRGKAGTGAGAVVCYSPMMVTAYGIWQGA
SPLDFSLPLFLLQVAIIVATTRLLVILLKPFRQPRVIAEILAGVILGPSVMGQVSTWAVK
VFPERSLLTLETVAHLGLLYFLFLVGLEMDVNTIRRSGKKALIIAVAGMALPFCIGTATS
FIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEVKLLNSDLGRIAMSAAIVNDMC
AWILLALAIAISEVNSSAFSSLWVLIAGVAFVLACFYVVRPLMWWIVRRVPEGEAIGDVH
ITLILTGVMVAGVCTDAIGIHSVFGAFVYGLVMPSGPLGVVLIEKLEDFVTGLLLPLFFA
ISGLRTNVTKVRDPITVGLLVLVFVMASFAKIMGTILIAVSYTMTFRDGVALGFLMNTRG
LVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVVTTVYRPARRLVGYKRRNLQRS
KHDAELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIYALHLVELTGRASNMLAAHHSA
SNPGGASDHIFNAFESYEEMVGGVSVQALTAASPYQTMHEDVCVLAEDKHVSLIVLPFHK
QQTVDGGMEPINASLRGFNESILASAPCSVGILVDRGLSAAAARMAAVHHVALLFFGGPD
DREGLAYAWRMVENPGVCLTIVRLIPPGYTAPAISPPQPPMPAAHSRAINVVPEVAKSER
QMDEEYLNEFRSRNLGNDAILYVEQVVANSEETVAAIRSQLDNAHELYIVGRHPGEASSP
LTSALAEWMESPELGPIGDLLVSSEFSKMASVLVMQQYVITAPLPPPVALAGPPTDDPVR
QYLTNANQRPSVAIGGNQMGAAGRGGWSGGAGGY
Download sequence
Identical sequences A2Y5W4
OsIBCD018408 39946.BGIOSIBCE019461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]