SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD020761 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD020761
Domain Number - Region: 85-164
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0165
Family Tetracyclin repressor-like, C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD020761
Sequence length 305
Comment 305
Sequence
MSVMETRPLSPRASPLPSSAKSPAGGGGGGGGGGFQWLFGKRGRRNRARQPLAAQLGPGD
DDGEEVEDEEDFFFVSTPYLSTPSWSAAAAAAGASPRKRGDHQAALARLRAAVLSVLARA
RRGGRRAGGGSSASARVLTGTVFGRLRGRVHLALQTDPRAAPAMMLELAGYSTGALVREM
ASGLVRLALECEKAAPPTNPGEKRRRAALMEETTWRAYCNGRKCGYAVRRECGAEEWRVL
RAVEPVTVGAGVLPDGGGVAGGEGDMMYMRARFERVVGSRDSEAFYMVSPDGNAGPELSI
YLLRV
Download sequence
Identical sequences B8B2T8 Q651K7
OsIBCD020761 XP_015642012.1.37577 39946.BGIOSIBCE022003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]