SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD021784 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD021784
Domain Number 1 Region: 1794-2039
Classification Level Classification E-value
Superfamily BEACH domain 4.45e-97
Family BEACH domain 0.000000071
Further Details:      
 
Domain Number 2 Region: 2143-2392
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-38
Family WD40-repeat 0.0075
Further Details:      
 
Domain Number 3 Region: 1624-1666,1705-1769
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-19
Family PreBEACH PH-like domain 0.0076
Further Details:      
 
Domain Number 4 Region: 175-254,282-334,458-580,845-1006,1086-1206
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000489
Family Clathrin heavy-chain linker domain 0.06
Further Details:      
 
Domain Number 5 Region: 637-762
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000271
Family Leech intramolecular trans-sialidase, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD021784
Sequence length 2408
Comment 2408
Sequence
MKQHQQQEATACSSEQQIVPWLKHNKKSQQQRKGTGLLPPRRRRCPPLRHLHRRQLSMEA
EEERRSPPSPPLQRQPHGVWLQGTTACRILAKTLQLYMIRTFRMVLVSKPTLLTAFREEG
VWDLIFSENCFYFGSSVEDMQFHIVAEVQNEDINGNTEPTDSESLYLSDVNILQLEAISF
LEYAATLNENKYNLPECSALLEALEHCIYDPVVVSILLKSFRVILQLATEQTLVSFKSLD
VITGVLKAACQQAKELQNFSCFPSDDVISSGYGSKIENIEMSSSGKRTEYAIICIELALS
LFKEYVTISSYGRILILHNPDCIECLFNLFQEKNFRKHVLEQIFALFRVKLCIFQIFSFD
LVNVWNYNTLTVYFNQLPPSSKQDHAAKLQLCSKYLENFTRANEKEKVNSELLVDLLVNM
REIIMMDRMYYQNLFRDGGCFLYIVSLLNGTFNEATGEQLVLNVLETLTLLLEGNDASKA
SFRMLVGVGYQTLQSLLLDFYKWLPSPSERLLHALLSMLNEDVVILVLNILQKSSTSLQH
YGLVVLQQLLKQSIANRTSCFRAGLLSYLLDWFSVEERDDTVGQIADLIQIIGAHSISGK
DIRKIFALLRCGKIVAKKKHSSLLLTCLSHMLKEKGPEAFFEFDGHDSGIEIKSPFQWPY
NRGLSFSCWLRVENFPENELPLETALMSTLSGITSSEASYPKMNEAMTHCTIGTKLMPVG
EQPISIGYERTFAFTGQMGPIYVFSDALSSEQIKGIYNLGPSYMYSFHGDDSLYRGILDA
RDGISSKIIFGFNAQASDSRSLFSVSSALDSADRSTFEATIMGGTNCNAVTDGEQSCHTS
VINGKLRAEVIELVASVLDANVSNQQQMYLLSGLSIMGFLLQSATPKLLNIETLSALKYM
FDVLRNCGNKQVVGDRPKIEEICKLRLLLLSLAEMSLKLQVSLADIRALASLFERNQDVA
CVEDILKMIIRALSEGPVLSSFLEHVNCLGGCCIFINLLKRFYQEHSWNYWLETSTKLDV
LKEYSLVSKGELDNVEIDEVILVRKLYALVLAYYLSAVKGGWHQLEDTVNYFLLKFGQGQ
LSSSYLLRDILDDIVGSLLQTSSEENIILSQPCCDNVLYLLKLIQELLFNQIGIKLLFPS
NPSEESLSSIKWKDDIKSTLNEILIDESHSQYKSFPWKSCQFADEDEKSEDWWNFFDKVW
DLICNLNGKGPNKLLPKGPNIEVPSLGQRARGLVESLNVPATEMAAAVVSGGIGTALGAK
INRFSEKATLLREEIFPRVFFHLVILYLCKAGLENASKCVLQFMSLLPVLISEDEQSKNK
LHFLIWSLLITRSQYGQLDDGARYHVLSHLILETIICGKSMLVPNILGRDDSMEIGNSNK
DTGFILNFVQKDRVLAAATVEVKHMKAVQADRLSQLDELQSKLNEHFTEETQLEKMIEDN
IHISITSALSADDKRKIAFRLAFDEDQQIVADKWIHISRALIDERGPWSANPFPNDVVTH
WKLDKTEDKWRRRLKLKRNYKFDERLCQPSYSRNESTEACVDQSSLSTKVPLKLKRFLLK
GVRAIFEDNAYEPIEDTNDTGESSQSSLLENQNPNNVSDLSDYRTAVQNKKESASNNGDN
DYTKVLCSVHCVLITPKRKLAGQLDITRTVLHFSFEFLVEGTGGSSVFSKFKEIEDSDCK
SDLGSVERLDGGRDYVIKTPNGVLMQKQSNKIKHHRRWNITKIKAVHWTRYLLQYTATEI
FFDDSNAPIFLNFSSQKDAKNAGSLLVSLRNEALFPKGSTKGKSRVISFVDRRVALEMAE
SARDRWIKREISNFEYLMILNTLAGRSYNDLTQYPVFPWVLTDYTSEKLDFNKSSTFRDL
SKPIGALDEKRFEVFEDRYVNFDDPDIPSFYYGSHYSTMGIVLHYLLRLEPFTTLHRSLQ
GGKFDHADRLFQSIDSAYKNSLSNTSDVKELIPEFFYMPEFLENSNSYHLGVRQDGEPLG
DVVLPPWAKAANIFYYVTYEGAVDLENMDDLLQKSAIEDQIANFGQTPIQIFRVKHPRRG
PPVPIAHPLYFAPQSIALTSSVSSTISHMSALLFIGLLDNTVILMNEGLVLSIKLWLTTQ
LQSGGNFTFSGPQDHFFGIGSDVISPRKIGTFLAENVNFGRQCLATMQINSDKYLILCGN
WENSFQIISLSDGRIVQSIRQHKDVVACVAVSSRGNVVATGSYDTTVMIWHAFRGRPSDH
VVMERPVHIFCGHDDIITCLFVSTELDIVISGSKDGTCIFHTLREGRYVRSIRHPSGIGL
SKLVASQHGRVVFYSESDLSLHMYSINGKHIASSASGGRINCMELSCCGQFLVCAGEHGQ
IVLHSMHCLDIIRRYDGAGKTITSLSVTPEECFLAGTKDGSLLVFSMESPLLRRKSMPRT
RIKPPTAS
Download sequence
Identical sequences OsIBCD021784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]