SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD022042 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD022042
Domain Number 1 Region: 249-637
Classification Level Classification E-value
Superfamily Aldolase 7.33e-154
Family GatZ-like 0.00000000527
Further Details:      
 
Domain Number 2 Region: 76-236
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.69e-33
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.095
Further Details:      
 
Domain Number 3 Region: 633-709
Classification Level Classification E-value
Superfamily PTS IIb component 7.32e-18
Family PTS IIb component 0.0017
Further Details:      
 
Domain Number 4 Region: 7-66
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000186
Family Restriction endonuclease FokI, N-terminal (recognition) domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD022042
Sequence length 1120
Comment 1120
Sequence
MPVNTAKRREHIIDLLCEHGSVRVEQLSKQFAVSTVTIRNDLRFLERKGCALRAYGGAML
NQQFAFDRPLRDKGRLNRDVKTLIANAAAGYVRDGEALILDSGSTTAQIVPFLKGRRDLV
VMTNALNIAYELSGNDGVEVMVLGGSVRRNSYSLYGPAAEQQLRQYRFDKLFLGVDGFDL
SAGITTPHPGEAHLNRVMCEVAREIIAVADASKFGRKSFCMIREAGQIHRLITDSRLPDD
YERALTELGVEAALRQAKSRGTPVLVEATSNQVNQFGGYTGQTAAQFRDTLWRLADEVGL
ARERVWLGGDHLGPNAWQDRPAQEAMALAETLIDDYVRAGFRKIHLDCSMSCAGDPSPLG
DAAVAERAARLCAVAERAWAQSGGEAPVYVIGTEVPVPGGAQEALAGLQVTTPQAVAQTL
EMHRIAWQKAELNDAWQRTIALVVQPGVEFDHHSVERYQPQRADALSHFIERQPGMIYEA
HSTDYQPPQAYRQLVRDHFAILKVGPALTFALREALFALDRIEREWLGERQSSQLRATLE
QVMREQPQQWSRYYHGTPHQQYLDRHYSLSDRVRYYWPQSQVQQAVDGLLDNLRRNPAPL
ALLSQYLPDQARALNAGELSTDPQEWVLHKVTQVGVTWTNTLGANLVVVANDEAAADPVQ
QNLMDMVVAEGVQTRYFTLQKTIDVIHKAADRQKIFLVCKTPQDVLTLLVWMGMVPLAGA
QPPNVVIGGVIGTAFAILTKADPKVAIGVAVPFSIAVQGCITLLFTLFSPMMHRCDRMVK
ALNWRGIERVNYLGIGILFIFYFVVAFLPIYFGADAASAMVQKAPGWLLDGLAVAGGMMP
AIGFSLLMKRRRPGPLRRRTPKMAFNDSDDLLAQKAEQRMAQALATSQVEQDDYLDSRPA
EALTRGDINRMAWRSLLLQASFNYERMQAGGWLYQLLPALRKIHRNPQDLANSMKMHMEF
INVHPFDVTFLSGLVLAMEQNKEKISTIRAVKVALMGPLGGIGDALFWLTLLPICAGIGA
SLALEGSLFGPIVFLLLFNLFHFGLRFGLAHYGYQAGTSALALLKTHTRRISHAASIVGM
TVIGALVASYVHLSTPLVMHAGKASVALQTDVLDNADSRR
Download sequence
Identical sequences B8B2J4
39946.BGIOSIBCE023327 OsIBCD022042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]